Web Server Statistics for M-Care Health Insurance Web Server Statistics for M-Care Health Insurance(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Successful requests: 1,172,687
Average successful requests per day: 37,831
Successful requests for pages: 112,882
Average successful requests for pages per day: 3,641
Failed requests: 369,609
Redirected requests: 86
Distinct files requested: 11,478
Distinct hosts served: 19,074
Corrupt logfile lines: 21
Unwanted logfile entries: 539
Data transferred: 7.828 Gbytes
Average data transferred per day: 258.594 Mbytes
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Each unit (
)
represents 2,000 requests for pages or part thereof.
week beg.: reqs: Gbytes: %bytes: %reqs: pages: ---------: ------: -------: ------: ------: -----: 27/Apr/03: 105585: 0.875: 11.19%: 9.00%: 13549:Busiest week: week beginning 4/May/03 (28,279 requests for pages).18/May/03: 320415: 2.138: 27.31%: 27.32%: 28112:
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Each unit ()
represents 400 requests for pages or part thereof.
date: reqs: Mbytes: %bytes: %reqs: pages: ---------: -----: -------: ------: ------: -----: 30/Apr/03: 5: 2.152: 0.03%: : 1:Busiest day: 20/May/03 (5,891 requests for pages).9/May/03: 41293: 246.026: 3.07%: 3.52%: 3601:
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Each unit ()
represents 1,500 requests for pages or part thereof.
day: reqs: Gbytes: %bytes: %reqs: pages: ---: ------: -------: ------: ------: -----: Sun: 72204: 0.483: 6.18%: 6.16%: 7771:
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Each unit ()
represents 400 requests for pages or part thereof.
hr: reqs: Mbytes: %bytes: %reqs: pages: --: -----: -------: ------: ------: -----: 0: 17936: 163.778: 2.04%: 1.53%: 2709:
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Listing domains with at least 0.5% of the traffic, sorted by the amount of traffic.
reqs: Gbytes: %bytes: %reqs: pages: domain ------: -------: ------: ------: -----: ------ 422945: 2.286: 29.21%: 36.07%: 25752: .net (Network) 12500: 0.071: 0.92%: 1.07%: 786: mich.net (MichNet dial-in lines) 273223: 2.255: 28.81%: 23.30%: 40985: .com (Commercial) 33941: 0.404: 5.16%: 2.89%: 4834: aol.com (America Online) 259559: 1.755: 22.43%: 22.13%: 25670: [unresolved numerical addresses] 16049: 0.115: 1.48%: 1.37%: 934: 141 11174: 0.068: 0.88%: 0.95%: 695: 141.211 (University of Michigan - Central Campus) 107029: 1.000: 12.79%: 9.13%: 13445: .edu (USA Educational) 88418: 0.869: 11.10%: 7.54%: 12037: umich.edu (University of Michigan) 32089: 0.532: 6.80%: 2.74%: 8804: med.umich.edu 8438: 0.050: 0.64%: 0.72%: 506: lsa.umich.edu 8350: 0.043: 0.56%: 0.71%: 449: engin.umich.edu 7888: 0.041: 0.53%: 0.67%: 469: uhs.umich.edu 36301: 0.159: 2.04%: 3.10%: 3138: .org (Non-Profit Making Organizations) 24620: 0.098: 1.26%: 2.10%: 764: .us (United States) 8299: 0.041: 0.53%: 0.71%: 446: .ca (Canada) 5057: 0.040: 0.51%: 0.43%: 324: .mil (USA Military) 35654: 0.189: 2.43%: 3.04%: 2358: [not listed: 80 domains]
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Listing the first 20 organisations by the number of requests, sorted by the number of requests.
reqs: %bytes: organisation ------: ------: ------------ 259839: 22.45%: [unresolved numerical addresses] 146419: 10.80%: comcast.net 88418: 11.10%: umich.edu 61355: 3.58%: ameritech.net 33941: 5.16%: aol.com 32309: 2.15%: ford.com 25924: 1.63%: rr.com 22570: 1.40%: level3.net 18266: 0.77%: co.washtenaw.mi.us 17880: 1.29%: wideopenwest.com 17041: 1.00%: attbi.com 15007: 0.70%: oakwood.org 12500: 0.92%: mich.net 12480: 0.78%: chartermi.net 9690: 0.70%: uu.net 9335: 1.91%: googlebot.com 8983: 0.51%: cox.net 8956: 1.30%: template.com 8495: 0.44%: att.net 7005: 0.50%: mindspring.com 356274: 30.91%: [not listed: 3,055 organisations]
(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Referrer Report: Search Word Report: Browser Report: Browser Summary: Operating System Report: Status Code Report: File Size Report: File Type Report: Directory Report: Request Report)
Listing hosts with at least 100 requests, sorted by the number of requests.
reqs: Gbytes: %bytes: %reqs: host ------: -------: ------: ------: ---- 22640: 0.095: 1.22%: 1.93%: 209.140.183.2 18266: 0.060: 0.77%: 1.56%: fw.co.washtenaw.mi.us 17085: 0.480: 6.14%: 1.46%: umhscache.med.umich.edu 15007: 0.054: 0.70%: 1.28%: firewall.oakwood.org 8956: 0.101: 1.30%: 0.76%: mail.template.com 7567: 0.036: 0.47%: 0.65%: 162-82-215-3.ded.ameritech.net 7001: 0.036: 0.47%: 0.60%: ncfmcc2.ford.com 6974: 0.035: 0.45%: 0.59%: ncecc2.ford.com 6771: 0.036: 0.47%: 0.58%: frasier.ford.com 5843: 0.036: 0.46%: 0.50%: ncfmcc1-ext.nb.ford.com 5720: 0.023: 0.30%: 0.49%: ncache1.ford.com 4848: 0.015: 0.20%: 0.41%: providence-library.stjohn.org 4748: 0.200: 2.57%: 0.40%: 155.91.64.10 4124: 0.013: 0.17%: 0.35%: tryifwclu 3578: 0.016: 0.21%: 0.31%: poncho.wafoote.org 3449: 0.008: 0.11%: 0.29%: 204.80.212.1 3417: 0.057: 0.74%: 0.29%: crawler11.googlebot.com 3410: 0.010: 0.13%: 0.29%: 152.160.58.33 3399: 0.052: 0.67%: 0.29%: crawler10.googlebot.com 3228: 0.049: 0.63%: 0.28%: s01a.gnmipr.gm.com 3213: 0.012: 0.16%: 0.27%: 207.74.160.8 3212: 0.005: 0.07%: 0.27%: 65.217.71.227 3122: 0.036: 0.47%: 0.27%: 170.232.0.254 3053: 0.015: 0.20%: 0.26%: pb.uhs.umich.edu 2871: 0.039: 0.51%: 0.24%: s02a.gnmipr.gm.com 2852: 0.024: 0.31%: 0.24%: defcon.aa.wl.com 2757: 0.017: 0.22%: 0.24%: edsiaah02.eds.net 2524: 0.006: 0.09%: 0.22%: 12.164.102.65 2482: 0.011: 0.15%: 0.21%: edsiaah01.eds.net 2403: 0.010: 0.13%: 0.20%: gw138127.net.hfh.edu 2362: 0.006: 0.08%: 0.20%: gw1.spartaninternet.com 2176: 0.006: 0.08%: 0.19%: internet-user.jwt.com 2116: 0.006: 0.08%: 0.18%: bgp01118394bgs.westln01.mi.comcast.net 1927: 0.005: 0.07%: 0.16%: bgp01084595bgs.wanarb01.mi.comcast.net 1843: 0.001: 0.03%: 0.16%: 67.36.25.201 1830: 0.008: 0.11%: 0.16%: 65.89.124.146 1739: 0.006: 0.08%: 0.15%: 199.105.205.130 1720: 0.016: 0.22%: 0.15%: 68.42.244.36 1652: 0.005: 0.07%: 0.14%: lib.stjohn.org 1587: 0.005: 0.07%: 0.14%: 63.73.224.101 1548: 0.003: 0.05%: 0.13%: 61.mumb.detr.sfldmibv.dsl.att.net 1480: 0.012: 0.17%: 0.13%: 136.181.195.17 1476: 0.004: 0.06%: 0.13%: nat2.cdimed.com 1462: 0.003: 0.04%: 0.12%: buckle.engin.umich.edu 1459: 0.024: 0.31%: 0.12%: crawler12.googlebot.com 1443: 0.003: 0.05%: 0.12%: 207.148.195.143 1418: 0.006: 0.09%: 0.12%: lb.uhs.umich.edu 1414: 0.072: 0.92%: 0.12%: 202.88.188.42 1399: 0.012: 0.15%: 0.12%: border.flint.umich.edu 1357: 0.006: 0.08%: 0.12%: pcp03379378pcs.gardnc01.mi.comcast.net 1351: 0.009: 0.12%: 0.12%: 162-82-215-199.ded.ameritech.net 1350: 0.001: 0.03%: 0.12%: host254.marriott.com 1334: 0.001: 0.02%: 0.11%: adsl-64-108-50-35.dsl.sfldmi.ameritech.net 1302: 0.001: 0.01%: 0.11%: 207.73.170.7 1279: 0.001: 0.02%: 0.11%: 63.89.85.15 1274: 0.003: 0.04%: 0.11%: oh-amelia5a-28.wre.adelphia.net 1256: 0.004: 0.05%: 0.11%: 12.118.238.86 1255: 0.005: 0.07%: 0.11%: 136.181.195.84 1237: 0.004: 0.06%: 0.11%: ws53.housing.umich.edu 1234: 0.007: 0.10%: 0.11%: 208.46.34.2 1230: 0.005: 0.07%: 0.10%: 67-37-201-106.ded.ameritech.net 1221: 0.002: 0.03%: 0.10%: 65.215.162.63 1217: 0.001: 0.02%: 0.10%: d60-198-136.try.wideopenwest.com 1201: 0.003: 0.04%: 0.10%: 208.230.87.25 1189: 0.015: 0.19%: 0.10%: 65.201.211.175 1186: 0.008: 0.11%: 0.10%: 208.49.101.190 1154: 0.001: 0.02%: 0.10%: pcp04072174pcs.sanarb01.mi.comcast.net 1131: 0.014: 0.18%: 0.10%: fw2.delphiauto.com 1124: 0.003: 0.04%: 0.10%: ppp-66-73-177-232.dsl.sfldmi.ameritech.net 1120: 0.007: 0.09%: 0.10%: sam.allmerica.com 1094: 0.011: 0.15%: 0.09%: 65.194.249.181 1093: 0.004: 0.06%: 0.09%: 65.196.52.227 1075: 0.005: 0.07%: 0.09%: 209.130.209.1 1074: 0.011: 0.15%: 0.09%: wcs1-cbus.nipr.mil 1068: 0.003: 0.04%: 0.09%: 12.148.61.163 1029: 0.004: 0.05%: 0.09%: host-17.subnet-17.med.umich.edu 1026: 0.001: 0.01%: 0.09%: bgp996511bgs.nanarb01.mi.comcast.net 1020: 0.002: 0.04%: 0.09%: 12.154.86.15 988: 0.068: 0.88%: 0.08%: kona.verity.com 983: 0.007: 0.10%: 0.08%: mfwcvsri01sun.cvs.com 977: 0.005: 0.07%: 0.08%: jets01g.es.adp.com 977: 0.006: 0.09%: 0.08%: 141.215.55.147 963: 0.011: 0.14%: 0.08%: 65.201.211.176 962: 0.004: 0.06%: 0.08%: 147.182.5.50 960: 0.007: 0.10%: 0.08%: aasec01254.fame.com 912: 0.000: 0.01%: 0.08%: cpe-24-221-84-227.mi.sprintbbd.net 911: 0.000: 0.01%: 0.08%: adsl-68-21-34-101.dsl.sfldmi.ameritech.net 908: 0.001: 0.03%: 0.08%: bgp995440bgs.nanarb01.mi.comcast.net 906: 0.004: 0.06%: 0.08%: jeg-66-20-250-194.jacobs.com 900: 0.003: 0.04%: 0.08%: 155.139.68.10 896: 0.001: 0.02%: 0.08%: 216.89.223.3 896: 0.001: 0.02%: 0.08%: ftp.isg-online.com 890: 0.011: 0.15%: 0.08%: 65.222.58.44 888: 0.002: 0.03%: 0.08%: d14-69-248-55.try.wideopenwest.com 878: 0.010: 0.13%: 0.07%: fw1.delphiauto.com 876: 0.000: 0.01%: 0.07%: epidkardia.sph.umich.edu 874: 0.001: 0.02%: 0.07%: 24.236.129.100.bay.mi.chartermi.net 874: 0.026: 0.33%: 0.07%: ree-cr-005.sac2.fastsearch.net 865: 0.000: 0.01%: 0.07%: 12.160.63.98 865: 0.003: 0.05%: 0.07%: 198.109.198.2 864: 0.001: 0.02%: 0.07%: mpls-fire-001.gmacrfc.com 861: 0.001: 0.02%: 0.07%: adsl-67-38-150-58.dsl.klmzmi.ameritech.net 856: 0.001: 0.02%: 0.07%: 141.215.89.39 853: 0.009: 0.12%: 0.07%: ce.metlife.com 852: 0.007: 0.10%: 0.07%: 198.108.51.9 848: 0.002: 0.03%: 0.07%: pcp03915690pcs.brghtn01.mi.comcast.net 841: 0.000: 0.01%: 0.07%: pcp02968409pcs.brghtn01.mi.comcast.net 839: 0.013: 0.18%: 0.07%: 65.247.90.49 837: 0.004: 0.05%: 0.07%: pcp01978679pcs.aubrnh01.mi.comcast.net 835: 0.003: 0.04%: 0.07%: pcp01199898pcs.watrfd01.mi.comcast.net 831: 0.006: 0.08%: 0.07%: 12.20.110.6 828: 0.002: 0.03%: 0.07%: client-151-198-243-110.qdx-it.com 828: 0.003: 0.05%: 0.07%: pcp04149693pcs.sanarb01.mi.comcast.net 822: 0.004: 0.06%: 0.07%: wcc4-43.wccnet.org 820: 0.001: 0.02%: 0.07%: mi-prod16.office.jstor.org 813: 0.000: : 0.07%: host-100.subnet-163.med.umich.edu 813: 0.004: 0.06%: 0.07%: kk.uhs.umich.edu 812: 0.001: 0.02%: 0.07%: bgp951828bgs.canton01.mi.comcast.net 810: 0.005: 0.07%: 0.07%: mfhnnadn01sun.nissan-usa.com 808: 0.001: 0.02%: 0.07%: pcp04150710pcs.sanarb01.mi.comcast.net 807: 0.002: 0.03%: 0.07%: host198.206-67-110.bignet.net 804: 0.001: 0.02%: 0.07%: pcp04072600pcs.sanarb01.mi.comcast.net 796: 0.004: 0.05%: 0.07%: 207.148.196.79 796: 0.003: 0.04%: 0.07%: w107.z064221050.det-mi.dsl.cnc.net 791: 0.004: 0.05%: 0.07%: bgp01113691bgs.westln01.mi.comcast.net 788: 0.000: 0.01%: 0.07%: bgp996181bgs.nanarb01.mi.comcast.net 778: 0.002: 0.03%: 0.07%: pcp02861405pcs.roylok01.mi.comcast.net 777: 0.007: 0.09%: 0.07%: sprint-198-70-2-200.lason.com 769: 0.000: 0.01%: 0.07%: 141-213-238-96.umnet.umich.edu 769: 0.002: 0.03%: 0.07%: 206.142.126.125 769: 0.003: 0.04%: 0.07%: northwood-157-129.reshall.umich.edu 768: 0.004: 0.06%: 0.07%: pcp02843092pcs.roylok01.mi.comcast.net 767: 0.003: 0.04%: 0.07%: sparky.umtri.umich.edu 762: 0.001: 0.02%: 0.06%: 128.238.35.94 762: 0.003: 0.04%: 0.06%: 207.179.79.33 762: 0.003: 0.04%: 0.06%: 152.160.27.253 759: 0.003: 0.04%: 0.06%: pcp03305715pcs.waren301.mi.comcast.net 754: 0.002: 0.03%: 0.06%: 166.90.202.52 751: 0.000: 0.01%: 0.06%: 64-205-218-162.client.dsl.net 749: 0.003: 0.04%: 0.06%: 155.139.50.14 749: 0.001: 0.02%: 0.06%: dsl093-001-093.det1.dsl.speakeasy.net 748: 0.005: 0.07%: 0.06%: 141.211.77.71 742: 0.001: 0.02%: 0.06%: 134.215.210.22 742: 0.002: 0.03%: 0.06%: 206.101.121.194 740: 0.004: 0.06%: 0.06%: pcp01123960pcs.frsrc101.mi.comcast.net 736: 0.001: 0.02%: 0.06%: bgp01080583bgs.wanarb01.mi.comcast.net 734: 0.002: 0.03%: 0.06%: 219.101.36.74 734: 0.002: 0.03%: 0.06%: pcp04073076pcs.sanarb01.mi.comcast.net 717: 0.021: 0.28%: 0.06%: 12.40.225.205 717: 0.006: 0.09%: 0.06%: wcs2-cbus.nipr.mil 704: 0.007: 0.10%: 0.06%: d14-69-9-61.try.wideopenwest.com 690: 0.003: 0.05%: 0.06%: 209.131.20.250 684: 0.002: 0.03%: 0.06%: adsl-68-73-52-108.dsl.sfldmi.ameritech.net 672: 0.006: 0.09%: 0.06%: 67.17.201.100 666: 0.001: 0.02%: 0.06%: pcp02255338pcs.wanarb01.mi.comcast.net 665: 0.001: 0.02%: 0.06%: user-0c93nsl.cable.mindspring.com 663: 0.003: 0.05%: 0.06%: adsl-67-37-197-105.dsl.sfldmi.ameritech.net 660: 0.006: 0.08%: 0.06%: 12.111.227.242 657: 0.001: 0.02%: 0.06%: pcp03571002pcs.wodhvn01.mi.comcast.net 654: 0.002: 0.03%: 0.06%: mieastlansd037.mi.nrcs.usda.gov 649: 0.003: 0.05%: 0.06%: 12.28.113.81 649: 0.000: 0.01%: 0.06%: pcm6210.sph.umich.edu 648: 0.001: 0.02%: 0.06%: rhsnpx2.hfhs.org 644: 0.002: 0.03%: 0.05%: adsl-68-73-53-206.dsl.sfldmi.ameritech.net 643: 0.000: 0.01%: 0.05%: cblmdm63-166-37-170.buckeye-express.com 643: 0.000: 0.01%: 0.05%: 12.242.255.54 635: 0.001: 0.02%: 0.05%: 68.22.13.2 631: 0.002: 0.03%: 0.05%: 12-245-252-200.client.attbi.com 630: 0.001: 0.02%: 0.05%: host-159.subnet-183.med.umich.edu 620: 0.010: 0.13%: 0.05%: host.metlife.com 617: 0.030: 0.39%: 0.05%: cache-rb07.proxy.aol.com 613: 0.003: 0.04%: 0.05%: 66-73-228-43.cms-email.com 613: 0.001: 0.02%: 0.05%: adsl-66-72-180-209.dsl.sfldmi.ameritech.net 611: 0.063: 0.81%: 0.05%: miami.verity.com 608: 0.001: 0.01%: 0.05%: adsl-68-73-198-34.dsl.sfldmi.ameritech.net 605: 0.000: 0.01%: 0.05%: bgp01082442bgs.wanarb01.mi.comcast.net 601: 0.004: 0.06%: 0.05%: pcp01115892pcs.flint01.mi.comcast.net 596: 0.024: 0.31%: 0.05%: cr2.turnitin.com 596: 0.001: 0.02%: 0.05%: nagelusa.com 595: 0.000: : 0.05%: host-148.subnet-151.med.umich.edu 591: 0.002: 0.04%: 0.05%: busfront.uhs.umich.edu 591: 0.003: 0.05%: 0.05%: 141.211.86.208 589: 0.002: 0.03%: 0.05%: adeskout.autodesk.com 586: 0.003: 0.04%: 0.05%: 12.159.32.3 585: 0.000: 0.01%: 0.05%: d60-152-200.try.wideopenwest.com 584: 0.001: 0.02%: 0.05%: cs666868-142.austin.rr.com 583: 0.002: 0.03%: 0.05%: 63.73.224.86 579: 0.000: 0.01%: 0.05%: 84.minneapolis-01rh16rt.mn.dial-access.att.net 577: 0.001: 0.02%: 0.05%: 24.213.14.226.bay.mi.chartermi.net 577: 0.003: 0.05%: 0.05%: 205.244.13.210 576: 0.001: 0.02%: 0.05%: host-123.subnet-75.med.umich.edu 576: 0.001: 0.02%: 0.05%: 12.149.97.4 573: 0.001: 0.02%: 0.05%: bgp01075849bgs.wanarb01.mi.comcast.net 573: 0.002: 0.03%: 0.05%: d14-69-93-245.try.wideopenwest.com 570: 0.004: 0.06%: 0.05%: annpc67.net.plm.eds.com 564: 0.001: 0.02%: 0.05%: 136.181.195.28 561: 0.002: 0.03%: 0.05%: deandffvt01.dean.lsa.umich.edu 561: 0.001: 0.02%: 0.05%: adsl-66-72-191-21.dsl.sfldmi.ameritech.net 557: 0.001: 0.01%: 0.05%: pcp03265185pcs.waldlk01.mi.comcast.net 557: 0.003: 0.05%: 0.05%: 66.243.9.141 556: 0.002: 0.04%: 0.05%: d53-118-140.try.wideopenwest.com 553: 0.003: 0.05%: 0.05%: pt2.uhs.umich.edu 550: 0.003: 0.05%: 0.05%: 165.215.90.20 545: 0.003: 0.04%: 0.05%: 166-90-246-53.digitalrealm.net 542: 0.001: 0.02%: 0.05%: 170.153.139.90 542: 0.003: 0.04%: 0.05%: 12.47.84.51 542: 0.002: 0.03%: 0.05%: 209.192.46.210 537: 0.004: 0.06%: 0.05%: ip67-92-144-194.z144-92-67.customer.algx.net 536: 0.003: 0.05%: 0.05%: 209.69.100.50 533: 0.001: 0.01%: 0.05%: 63.122.173.7 530: 0.000: 0.01%: 0.05%: 24.247.165.205.bay.mi.chartermi.net 529: 0.002: 0.03%: 0.05%: 12.40.225.211 529: 0.003: 0.05%: 0.05%: 65.195.105.101 526: 0.003: 0.04%: 0.04%: 12.47.73.242 523: 0.000: 0.01%: 0.04%: 24.247.214.81.bay.mi.chartermi.net 514: 0.000: 0.01%: 0.04%: adsl-64-108-76-84.dsl.lgnnmi.ameritech.net 512: 0.003: 0.04%: 0.04%: adsl-68-21-35-236.dsl.sfldmi.ameritech.net 511: 0.000: 0.01%: 0.04%: adsl-66-73-13-28.dsl.sfldmi.ameritech.net 510: 0.002: 0.03%: 0.04%: pcp01112954pcs.flint01.mi.comcast.net 510: 0.002: 0.03%: 0.04%: host219.64-31-3.bignet.net 509: 0.002: 0.03%: 0.04%: adsl-67-37-197-91.dsl.sfldmi.ameritech.net 509: 0.000: 0.01%: 0.04%: rrcs-central-24-92-128-101.biz.rr.com 509: 0.000: 0.01%: 0.04%: 69.14.178.243 505: 0.003: 0.05%: 0.04%: 64.242.220.9 503: 0.001: 0.02%: 0.04%: patuser.promedica.org 503: 0.000: 0.01%: 0.04%: 63.146.32.83 502: 0.001: 0.02%: 0.04%: gppg-017.hou.tx.bbnow.net 500: 0.002: 0.03%: 0.04%: pcp01639261pcs.rocsth01.mi.comcast.net 500: 0.003: 0.05%: 0.04%: 63.140.234.4 499: 0.005: 0.07%: 0.04%: 136.181.195.9 499: 0.002: 0.03%: 0.04%: dtw-dsl163-cust176.mpowercom.net 498: 0.000: 0.01%: 0.04%: 208.134.64.130 497: 0.001: 0.02%: 0.04%: wcs2-scott.nipr.mil 496: 0.021: 0.27%: 0.04%: cr3.turnitin.com 495: 0.001: 0.02%: 0.04%: pm433-01.dialip.mich.net 495: 0.001: 0.02%: 0.04%: adsl-66-72-189-109.dsl.sfldmi.ameritech.net 493: 0.002: 0.03%: 0.04%: h-64-105-102-204.sfldmidn.covad.net 491: 0.002: 0.03%: 0.04%: router.schostak.com 491: 0.001: 0.02%: 0.04%: 68-72-242-34.alcos.com 491: 0.002: 0.03%: 0.04%: 207.91.231.101 490: 0.000: 0.01%: 0.04%: adsl-68-73-59-53.dsl.sfldmi.ameritech.net 487: 0.000: 0.01%: 0.04%: h-66-134-148-150.sfldmidn.covad.net 487: 0.002: 0.03%: 0.04%: bgp967227bgs.derbrn01.mi.comcast.net 486: 0.003: 0.04%: 0.04%: 209.69.172.34 485: 0.004: 0.06%: 0.04%: host54.lan.sequoianet.com 481: 0.001: 0.02%: 0.04%: 207.148.211.131 476: 0.003: 0.04%: 0.04%: pcp02588076pcs.shlb1201.mi.comcast.net 474: 0.000: 0.01%: 0.04%: 12-241-184-28.client.attbi.com 472: 0.000: 0.01%: 0.04%: pcp02254972pcs.wanarb01.mi.comcast.net 471: 0.000: 0.01%: 0.04%: gchraptor1.gchosp.org 471: 0.001: 0.03%: 0.04%: host-235.subnet-148.med.umich.edu 470: 0.002: 0.03%: 0.04%: humibmzgn01.dhcp.lsa.umich.edu 468: 0.000: 0.01%: 0.04%: adsl-68-73-55-128.dsl.sfldmi.ameritech.net 468: 0.002: 0.03%: 0.04%: pcp01154460pcs.newhav01.mi.comcast.net 458: 0.003: 0.04%: 0.04%: 63.171.81.135 457: 0.001: 0.02%: 0.04%: obj1932.brmngh01.mi.comcast.net 456: 0.000: 0.01%: 0.04%: gatekeeper.arvin.com 456: 0.000: 0.01%: 0.04%: adsl-66-73-5-165.dsl.sfldmi.ameritech.net 454: 0.003: 0.05%: 0.04%: user.mascohq.com 451: 0.002: 0.04%: 0.04%: 216.183.249.66 448: 0.001: 0.02%: 0.04%: dialup-67.72.215.175.dial1.detroit1.level3.net 448: 0.003: 0.04%: 0.04%: 204.38.186.17 447: 0.001: 0.02%: 0.04%: c-67-161-30-159.client.comcast.net 446: 0.000: 0.01%: 0.04%: host-211.subnet-60.med.umich.edu 445: 0.000: 0.01%: 0.04%: host-148.subnet-144.med.umich.edu 445: 0.002: 0.03%: 0.04%: bgp948580bgs.canton01.mi.comcast.net 445: 0.000: 0.01%: 0.04%: bgp01074012bgs.vnburn01.mi.comcast.net 444: 0.000: 0.01%: 0.04%: dtw-dsl213-cust131.mpowercom.net 442: 0.003: 0.04%: 0.04%: 198.36.90.68 442: 0.000: : 0.04%: pm66.internetseer.net 442: 0.000: 0.01%: 0.04%: h46det.borgwarner.com 441: 0.005: 0.06%: 0.04%: pm476-26.dialip.mich.net 441: 0.001: 0.03%: 0.04%: d60-78-214.try.wideopenwest.com 440: 0.003: 0.05%: 0.04%: proxy2.bcbsm.com 440: 0.001: 0.02%: 0.04%: insight-205.umich.net 439: 0.003: 0.04%: 0.04%: 209.104.149.7 438: 0.002: 0.03%: 0.04%: bgp998811bgs.nanarb01.mi.comcast.net 437: 0.002: 0.03%: 0.04%: bilbo.aadl.org 434: 0.001: 0.02%: 0.04%: pcp02026752pcs.pntiac01.mi.comcast.net 433: 0.001: 0.02%: 0.04%: ppp278.che.centurytel.net 431: 0.002: 0.03%: 0.04%: pcp01155157pcs.newhav01.mi.comcast.net 428: 0.000: 0.01%: 0.04%: 198.2.12.12 428: 0.001: 0.02%: 0.04%: rhodium.engin.umich.edu 425: 0.007: 0.10%: 0.04%: bgp01064627bgs.taylor01.mi.comcast.net 424: 0.003: 0.05%: 0.04%: burleson.rtp.epa.gov 424: 0.002: 0.03%: 0.04%: wwwproxy-2.sns-felb.debis.de 423: 0.000: 0.01%: 0.04%: as16-tol-oh-1-60.rasserver.net 421: 0.000: 0.01%: 0.04%: ip68-100-21-72.nv.nv.cox.net 420: 0.001: 0.02%: 0.04%: ip68-8-69-50.sd.sd.cox.net 419: 0.009: 0.12%: 0.04%: 167.127.104.11 419: 0.001: 0.02%: 0.04%: bdsl.66.14.180.99.gte.net 418: 0.002: 0.03%: 0.04%: eng2j6m10b.english.lsa.umich.edu 418: 0.006: 0.08%: 0.04%: wb1.stanford.edu 415: 0.001: 0.02%: 0.04%: dedport-128-217.idealapps.com 414: 0.001: 0.02%: 0.04%: tnt02-66-130.sfld.provide.net 412: 0.001: 0.01%: 0.04%: adsl-68-21-39-67.dsl.sfldmi.ameritech.net 411: 0.007: 0.09%: 0.04%: egspd426.teoma.com 410: 0.000: 0.01%: 0.03%: psyc-bus05.psych.lsa.umich.edu 410: 0.001: 0.02%: 0.03%: d6.as0.sfld.mi.voyager.net 409: 0.002: 0.04%: 0.03%: kepeswinemcneilagepcattys-kepeswinem-psr1111034.z110-89-67.customer.algx.net 409: 0.001: 0.02%: 0.03%: 208.178.215.125 407: 0.001: 0.02%: 0.03%: cpe-024-210-100-009.twmi.rr.com 405: 0.002: 0.03%: 0.03%: 12.148.43.195 404: 0.000: : 0.03%: adsl-68-73-196-104.dsl.sfldmi.ameritech.net 402: 0.000: : 0.03%: 66.150.40.81 401: 0.001: 0.02%: 0.03%: 12.27.0.202 401: 0.000: 0.01%: 0.03%: host-168.subnet-182.med.umich.edu 400: 0.001: 0.02%: 0.03%: d57-7-165.home.cgocable.net 400: 0.000: 0.01%: 0.03%: bgp504744bgs.verona01.nj.comcast.net 399: 0.002: 0.03%: 0.03%: host-58.subnet-88.med.umich.edu 398: 0.000: 0.01%: 0.03%: pc114.caymanchem.com 397: 0.002: 0.04%: 0.03%: adsl-68-74-25-65.dsl.sgnwmi.ameritech.net 397: 0.001: 0.02%: 0.03%: coral.tci.com 397: 0.001: 0.02%: 0.03%: pcp01107045pcs.clntn201.mi.comcast.net 396: 0.001: 0.02%: 0.03%: 216-150-228-183.webandnetworksolutions.com 396: 0.002: 0.03%: 0.03%: 136.181.195.25 395: 0.001: 0.03%: 0.03%: bgp01048611bgs.southg01.mi.comcast.net 394: 0.001: 0.02%: 0.03%: 63.165.216.82.bay.mi.chartermi.net 393: 0.000: 0.01%: 0.03%: 198.111.188.2 393: 0.001: 0.03%: 0.03%: 207.179.80.110 393: 0.001: 0.02%: 0.03%: pcp04149712pcs.sanarb01.mi.comcast.net 393: 0.002: 0.03%: 0.03%: 216.11.89.148 392: 0.000: : 0.03%: 152.160.27.100 392: 0.001: 0.02%: 0.03%: 1cust159.tnt25.det5.da.uu.net 391: 0.002: 0.03%: 0.03%: adsl-65-43-39-189.dsl.lgtpmi.ameritech.net 391: 0.000: 0.01%: 0.03%: acaff-4-029.acadaff.umich.edu 390: 0.000: 0.01%: 0.03%: 4.17.129.194 390: 0.002: 0.03%: 0.03%: emerson.marcdatabase.com 388: 0.005: 0.07%: 0.03%: 131.107.163.47 387: 0.001: 0.01%: 0.03%: nat240.ariba.com 387: 0.005: 0.07%: 0.03%: pcp01112658pcs.flint01.mi.comcast.net 387: 0.000: 0.01%: 0.03%: bgp01051139bgs.southg01.mi.comcast.net 386: 0.001: 0.02%: 0.03%: pcp02254937pcs.wanarb01.mi.comcast.net 386: 0.002: 0.04%: 0.03%: 141-211-137-106.dev.umich.edu 385: 0.003: 0.04%: 0.03%: bgp01084458bgs.wanarb01.mi.comcast.net 385: 0.000: 0.01%: 0.03%: 141.211.136.35 385: 0.005: 0.07%: 0.03%: aaron-rogtat-s-computer-udp1162220uds.wustl.edu 384: 0.001: 0.02%: 0.03%: host-23.subnet-126.med.umich.edu 382: 0.001: 0.02%: 0.03%: bgp01114618bgs.westln01.mi.comcast.net 382: 0.005: 0.07%: 0.03%: 198.109.173.45 381: 0.002: 0.03%: 0.03%: d60-42-205.try.wideopenwest.com 380: 0.002: 0.03%: 0.03%: pcp02395731pcs.flint01.mi.comcast.net 380: 0.004: 0.05%: 0.03%: adsl-68-73-52-45.dsl.sfldmi.ameritech.net 380: 0.000: 0.01%: 0.03%: adsl-68-22-6-70.dsl.sfldmi.ameritech.net 379: 0.003: 0.04%: 0.03%: ppp-66-73-180-92.dsl.sfldmi.ameritech.net 378: 0.004: 0.06%: 0.03%: bgp01010865bgs.rockwd01.mi.comcast.net 378: 0.003: 0.04%: 0.03%: safety.bf.umich.edu 378: 0.001: 0.02%: 0.03%: bgp974610bgs.fenkel01.mi.comcast.net 377: 0.002: 0.03%: 0.03%: pcp01640148pcs.rocsth01.mi.comcast.net 376: 0.001: 0.02%: 0.03%: 207.230.138.240 376: 0.001: 0.01%: 0.03%: 66-208-218-203.ubr01b.pntiac01.mi.hfc.comcastbusiness.net 376: 0.001: 0.02%: 0.03%: pcp03102219pcs.ypwest01.mi.comcast.net 376: 0.003: 0.04%: 0.03%: 152.160.29.58 376: 0.002: 0.03%: 0.03%: bgp948338bgs.canton01.mi.comcast.net 375: 0.000: 0.01%: 0.03%: pcp04114119pcs.plyntv01.mi.comcast.net 375: 0.001: 0.02%: 0.03%: 129.9.163.106 375: 0.000: 0.01%: 0.03%: dialup-67.72.218.139.dial1.detroit1.level3.net 374: 0.005: 0.07%: 0.03%: cr4.turnitin.com 373: 0.003: 0.04%: 0.03%: 136.181.195.7 372: 0.001: 0.02%: 0.03%: 141.211.224.123 371: 0.001: 0.01%: 0.03%: pcp04040093pcs.wbrmfd01.mi.comcast.net 370: 0.000: 0.01%: 0.03%: 66.227.249.211.bay.mi.chartermi.net 370: 0.003: 0.04%: 0.03%: info.mckesson.com 368: 0.001: 0.02%: 0.03%: dialup-67.72.196.119.dial1.detroit1.level3.net 368: 0.002: 0.03%: 0.03%: bgp934783bgs.brmngh01.mi.comcast.net 368: 0.002: 0.03%: 0.03%: pt-tr-nrtowler.bf.umich.edu 368: 0.003: 0.05%: 0.03%: ns1.altarum.org 366: 0.003: 0.04%: 0.03%: hollyhcc.router.ciberlynx.net 365: 0.001: 0.02%: 0.03%: tren71.trenton.lib.mi.us 365: 0.001: 0.02%: 0.03%: 163.wg130.dtrt.sflmi01r1.dsl.att.net 365: 0.000: 0.01%: 0.03%: corp.external.dfw.algx.net 363: 0.001: 0.02%: 0.03%: 208-39-170-79.isp.comcastbusiness.net 363: 0.003: 0.05%: 0.03%: tren116.trenton.lib.mi.us 362: 0.000: : 0.03%: someuser.relianceinsurance.com 362: 0.001: 0.02%: 0.03%: adsl-66-72-188-98.dsl.sfldmi.ameritech.net 362: 0.001: 0.01%: 0.03%: as16-tol-oh-1-140.rasserver.net 361: 0.001: 0.01%: 0.03%: pcp03265182pcs.waldlk01.mi.comcast.net 360: 0.002: 0.03%: 0.03%: bgp01036878bgs.sothfd01.mi.comcast.net 360: 0.001: 0.02%: 0.03%: cache-1.lnh.md.webcache.rcn.net 359: 0.002: 0.03%: 0.03%: dialup-67.72.221.200.dial1.detroit1.level3.net 357: 0.001: 0.02%: 0.03%: mancare.uhs.umich.edu 357: 0.001: 0.01%: 0.03%: adsl-66-73-216-190.dsl.sfldmi.ameritech.net 357: 0.002: 0.03%: 0.03%: pcp02801269pcs.clntn201.mi.comcast.net 355: 0.000: 0.01%: 0.03%: bgp01007227bgs.plyntv01.mi.comcast.net 355: 0.002: 0.03%: 0.03%: lan3.wolf.net 355: 0.001: 0.02%: 0.03%: nat1.per-se.com 355: 0.002: 0.03%: 0.03%: pcp02255974pcs.wanarb01.mi.comcast.net 354: 0.001: 0.02%: 0.03%: host-224.subnet-60.med.umich.edu 354: 0.001: 0.02%: 0.03%: 65-84-248-162.client.dsl.net 354: 0.001: 0.01%: 0.03%: 170.94.134.144 353: 0.004: 0.06%: 0.03%: 012-111-248-245.comwavz.net 352: 0.001: 0.02%: 0.03%: 65.117.138.22 352: 0.001: 0.02%: 0.03%: dedport-138-41.idealapps.com 351: 0.000: 0.01%: 0.03%: bgp01116831bgs.westln01.mi.comcast.net 351: 0.000: 0.01%: 0.03%: sdn-ap-019ilchicp0421.dialsprint.net 351: 0.001: 0.02%: 0.03%: h-64-105-103-222.sfldmidn.covad.net 349: 0.001: 0.02%: 0.03%: nic-29-c97-155.twmi.rr.com 348: 0.004: 0.05%: 0.03%: 213.215.133.19 348: 0.001: 0.01%: 0.03%: 24.247.82.8.bay.mi.chartermi.net 347: 0.001: 0.02%: 0.03%: matrix3-99-170.ppp.netnitco.net 347: 0.000: 0.01%: 0.03%: 162.44.245.32 346: 0.001: 0.02%: 0.03%: nurse-213.nursing.umich.edu 346: 0.001: 0.02%: 0.03%: 12-212-240-76.client.attbi.com 344: 0.000: 0.01%: 0.03%: adsl-68-73-111-213.dsl.sfldmi.ameritech.net 343: 0.000: : 0.03%: pcp01196069pcs.watrfd01.mi.comcast.net 343: 0.002: 0.03%: 0.03%: adsl-68-73-199-25.dsl.sfldmi.ameritech.net 343: 0.002: 0.03%: 0.03%: cache-rh08.proxy.aol.com 343: 0.000: 0.01%: 0.03%: reggieh.engin.umich.edu 341: 0.001: 0.01%: 0.03%: bgp999395bgs.plyntv01.mi.comcast.net 341: 0.001: 0.01%: 0.03%: dhcp024-208-253-176.twmi.rr.com 340: 0.000: 0.01%: 0.03%: bgp01138364bgs.ypwest01.mi.comcast.net 339: 0.001: 0.01%: 0.03%: pcp04150259pcs.sanarb01.mi.comcast.net 339: 0.000: 0.01%: 0.03%: ws409.housing.umich.edu 338: 0.001: 0.02%: 0.03%: 141.211.77.103 338: 0.001: 0.01%: 0.03%: 12.20.111.254 337: 0.004: 0.06%: 0.03%: 20.137.34.50 335: 0.002: 0.03%: 0.03%: 204.24.21.10 335: 0.000: : 0.03%: 140.90.251.237 334: 0.001: 0.02%: 0.03%: host-206.subnet-72.med.umich.edu 334: 0.001: 0.02%: 0.03%: adsl-67-38-80-62.dsl.sfldmi.ameritech.net 334: 0.002: 0.04%: 0.03%: dhcp024-208-255-197.twmi.rr.com 333: 0.001: 0.02%: 0.03%: bgp998975bgs.nanarb01.mi.comcast.net 333: 0.001: 0.02%: 0.03%: sangwonl.personal.engin.umich.edu 330: 0.000: 0.01%: 0.03%: 216.157.193.162 329: 0.001: 0.02%: 0.03%: bgp01076034bgs.wanarb01.mi.comcast.net 328: 0.002: 0.04%: 0.03%: dhcp024-208-238-022.twmi.rr.com 327: 0.001: 0.02%: 0.03%: poseidon.sears.com 327: 0.000: 0.01%: 0.03%: 205.245.95.80 326: 0.004: 0.05%: 0.03%: cache-dk04.proxy.aol.com 325: 0.000: 0.01%: 0.03%: agdcgw01.akingump.com 322: 0.002: 0.03%: 0.03%: d14-69-132-150.try.wideopenwest.com 322: 0.002: 0.03%: 0.03%: jawa.iocenter.net 321: 0.002: 0.04%: 0.03%: adsl-68-74-0-33.dsl.sfldmi.ameritech.net 321: 0.000: 0.01%: 0.03%: pm852-35.dialip.mich.net 320: 0.003: 0.05%: 0.03%: gwv.dteenergy.com 320: 0.001: 0.02%: 0.03%: nic-29-c123-88.twmi.rr.com 320: 0.001: 0.01%: 0.03%: astr-830denn-1.astro.lsa.umich.edu 319: 0.000: 0.01%: 0.03%: d14-69-69-100.try.wideopenwest.com 319: 0.002: 0.03%: 0.03%: 66.227.143.114.bay.mi.chartermi.net 319: 0.001: 0.02%: 0.03%: bgp01113178bgs.westln01.mi.comcast.net 318: 0.002: 0.03%: 0.03%: bgp01137062bgs.ypwest01.mi.comcast.net 317: 0.001: 0.02%: 0.03%: 65.106.45.126 317: 0.000: 0.01%: 0.03%: bgp01138140bgs.ypwest01.mi.comcast.net 316: 0.000: 0.01%: 0.03%: w002.z209220231.nyc-ny.dsl.cnc.net 316: 0.000: 0.01%: 0.03%: 65.170.176.6 315: 0.001: 0.02%: 0.03%: 12.47.73.241 315: 0.001: 0.02%: 0.03%: 12-245-232-48.client.attbi.com 314: 0.001: 0.02%: 0.03%: res6.gtwy.uscourts.gov 313: 0.002: 0.03%: 0.03%: pcp04069884pcs.sanarb01.mi.comcast.net 313: 0.001: 0.02%: 0.03%: pcp03572767pcs.wodhvn01.mi.comcast.net 313: 0.000: 0.01%: 0.03%: permedion.com 312: 0.002: 0.03%: 0.03%: d60-103-227.try.wideopenwest.com 312: 0.000: 0.01%: 0.03%: mail.familyhealthpc.com 312: 0.003: 0.04%: 0.03%: 141-211-29-124.bus.umich.edu 311: 0.000: 0.01%: 0.03%: adsl-68-72-239-241.dsl.sfldmi.ameritech.net 311: 0.004: 0.06%: 0.03%: 162.108.31.17 311: 0.002: 0.03%: 0.03%: pcp02861351pcs.roylok01.mi.comcast.net 311: 0.001: 0.01%: 0.03%: bgp01098158bgs.warn1201.mi.comcast.net 310: 0.017: 0.22%: 0.03%: cache-mtc-ab02.proxy.aol.com 310: 0.004: 0.06%: 0.03%: igate.highmark.com 309: 0.000: 0.01%: 0.03%: pcp02256518pcs.wanarb01.mi.comcast.net 309: 0.002: 0.03%: 0.03%: myna.bsd.uchicago.edu 308: 0.002: 0.03%: 0.03%: 162.108.13.32 308: 0.001: 0.02%: 0.03%: 141.215.64.220 307: 0.002: 0.03%: 0.03%: cesium.engin.umich.edu 304: 0.002: 0.03%: 0.03%: pcp02523758pcs.nromeo01.mi.comcast.net 304: 0.000: 0.01%: 0.03%: pcp01944321pcs.canton01.mi.comcast.net 303: 0.000: 0.01%: 0.03%: predator.cvty.com 303: 0.001: 0.02%: 0.03%: host-83.subnet-194.med.umich.edu 303: 0.001: 0.02%: 0.03%: 141.211.109.150 303: 0.002: 0.03%: 0.03%: 65.211.128.235 302: 0.002: 0.03%: 0.03%: 1cust250.tnt35.det5.da.uu.net 302: 0.001: 0.02%: 0.03%: 141.211.226.123 301: 0.001: 0.01%: 0.03%: smtp-gw.msms.org 301: 0.001: 0.02%: 0.03%: bgp01000604bgs.plyntv01.mi.comcast.net 301: 0.002: 0.03%: 0.03%: bgp01132202bgs.ypeast01.mi.comcast.net 300: 0.001: 0.02%: 0.03%: 141-211-90-197.dsa.umich.edu 300: 0.000: 0.01%: 0.03%: adsl-66-72-178-94.dsl.sfldmi.ameritech.net 300: 0.001: 0.02%: 0.03%: pcp01925733pcs.canton01.mi.comcast.net 298: 0.001: 0.01%: 0.03%: dialup-67.72.196.176.dial1.detroit1.level3.net 298: 0.002: 0.03%: 0.03%: 66.227.207.182.bay.mi.chartermi.net 298: 0.002: 0.03%: 0.03%: nic-29-c115-173.twmi.rr.com 298: 0.000: : 0.03%: accel23.nyc.untd.com 298: 0.001: 0.02%: 0.03%: bgp999725bgs.plyntv01.mi.comcast.net 297: 0.001: 0.02%: 0.03%: 66-2-148-42-det-01.cvx.algx.net 296: 0.000: 0.01%: 0.03%: 209.69.198.170 296: 0.001: 0.02%: 0.03%: adsl-67-38-17-187.dsl.sfldmi.ameritech.net 296: 0.001: 0.02%: 0.03%: 63.241.137.3 296: 0.001: 0.02%: 0.03%: pcp03266513pcs.waldlk01.mi.comcast.net 296: 0.000: : 0.03%: 66.150.40.75 295: 0.000: 0.01%: 0.03%: nic-29-c122-176.twmi.rr.com 295: 0.000: : 0.03%: adsl-64-171-14-67.dsl.sntc01.pacbell.net 295: 0.003: 0.05%: 0.03%: 161.150.2.31 295: 0.001: 0.02%: 0.03%: pcp01193834pcs.waldlk01.mi.comcast.net 295: 0.001: 0.02%: 0.03%: adsl-68-74-28-103.dsl.sfldmi.ameritech.net 294: 0.002: 0.04%: 0.03%: bgp01064977bgs.taylor01.mi.comcast.net 294: 0.001: 0.01%: 0.03%: bgp977356bgs.gardnc01.mi.comcast.net 293: 0.000: 0.01%: 0.02%: wks.enlighten.com 293: 0.001: 0.02%: 0.02%: 63.73.224.102 293: 0.000: 0.01%: 0.02%: 141.211.46.44 292: 0.002: 0.03%: 0.02%: 66.227.154.236.bay.mi.chartermi.net 292: 0.000: 0.01%: 0.02%: dialup-67.72.218.246.dial1.detroit1.level3.net 292: 0.000: 0.01%: 0.02%: isr-126-171.isr.umich.edu 292: 0.001: 0.02%: 0.02%: 64-211-38-20.dsl1.hnv.mi.frontiernet.net 292: 0.000: 0.01%: 0.02%: pcp03575148pcs.wodhvn01.mi.comcast.net 291: 0.001: 0.02%: 0.02%: 175-pool1.ras11.misou.alerondial.net 289: 0.001: 0.02%: 0.02%: 141.211.151.182 289: 0.003: 0.04%: 0.02%: 24.247.95.81.bay.mi.chartermi.net 289: 0.000: : 0.02%: watchdog.ihs-inc.com 289: 0.004: 0.06%: 0.02%: crawl24.googlebot.com 288: 0.004: 0.05%: 0.02%: crawl23.googlebot.com 286: 0.000: : 0.02%: visadm.iocenter.net 285: 0.000: 0.01%: 0.02%: 207.74.200.70 285: 0.000: 0.01%: 0.02%: bgp01136780bgs.ypwest01.mi.comcast.net 284: 0.003: 0.05%: 0.02%: bgp994617bgs.nanarb01.mi.comcast.net 284: 0.002: 0.04%: 0.02%: irwg8lbp10b.irwg.lsa.umich.edu 283: 0.001: 0.02%: 0.02%: adsl-67-38-31-234.dsl.sfldmi.ameritech.net 283: 0.002: 0.03%: 0.02%: econ240r.econ.lsa.umich.edu 283: 0.001: 0.01%: 0.02%: 68-22-13-34.ded.ameritech.net 282: 0.000: 0.01%: 0.02%: pcp01925376pcs.canton01.mi.comcast.net 282: 0.001: 0.01%: 0.02%: bgp987370bgs.madsnh01.mi.comcast.net 282: 0.001: 0.01%: 0.02%: adsl-66-72-177-152.dsl.sfldmi.ameritech.net 282: 0.000: 0.01%: 0.02%: adsl-68-73-192-39.dsl.sfldmi.ameritech.net 281: 0.000: 0.01%: 0.02%: gongos-1.s213474-1.uschcg2.bsn.savis.net 280: 0.001: 0.01%: 0.02%: pcp01188460pcs.strl401.mi.comcast.net 280: 0.000: 0.01%: 0.02%: bgp01036177bgs.sothfd01.mi.comcast.net 280: 0.000: 0.01%: 0.02%: pcp02197134pcs.plyntv01.mi.comcast.net 280: 0.002: 0.03%: 0.02%: igfw.nationalsteel.com 279: 0.002: 0.03%: 0.02%: pc-128.music.umich.edu 279: 0.001: 0.02%: 0.02%: pcp02853834pcs.roylok01.mi.comcast.net 279: 0.000: 0.01%: 0.02%: 152.160.192.22 279: 0.001: 0.02%: 0.02%: d53-232-199.try.wideopenwest.com 278: 0.001: 0.02%: 0.02%: adsl-66-73-6-118.dsl.sfldmi.ameritech.net 278: 0.002: 0.03%: 0.02%: 152.160.43.58 277: 0.015: 0.19%: 0.02%: cache-db08.proxy.aol.com 277: 0.001: 0.02%: 0.02%: heat-pc2.engin.umich.edu 276: 0.002: 0.03%: 0.02%: orgtbxw1t01.geo.lsa.umich.edu 276: 0.001: 0.02%: 0.02%: bgp01115403bgs.westln01.mi.comcast.net 275: 0.000: : 0.02%: cache-mtc-ac03.proxy.aol.com 274: 0.001: 0.02%: 0.02%: adsl-68-73-59-169.dsl.sfldmi.ameritech.net 274: 0.001: 0.02%: 0.02%: acac7d87.ipt.aol.com 273: 0.000: : 0.02%: bode.eecs.umich.edu 273: 0.001: 0.02%: 0.02%: po-ad-vamo2.bf.umich.edu 273: 0.002: 0.03%: 0.02%: pcp04073453pcs.sanarb01.mi.comcast.net 273: 0.001: 0.02%: 0.02%: d53-249-236.try.wideopenwest.com 273: 0.002: 0.03%: 0.02%: cache-dg05.proxy.aol.com 272: 0.002: 0.03%: 0.02%: obj205.brmngh01.mi.comcast.net 272: 0.001: 0.01%: 0.02%: pcp04068786pcs.sanarb01.mi.comcast.net 272: 0.002: 0.03%: 0.02%: mail.fsqc.com 272: 0.000: 0.01%: 0.02%: c3-85.davenport.edu 271: 0.000: : 0.02%: host-59.subnet-127.med.umich.edu 271: 0.002: 0.03%: 0.02%: adsl-64-172-46-163.dsl.snfc21.pacbell.net 271: 0.002: 0.03%: 0.02%: 144b-143.umd.edu 271: 0.000: 0.01%: 0.02%: adsl-67-36-74-238.dsl.sfldmi.ameritech.net 270: 0.002: 0.03%: 0.02%: 141-211-29-201.bus.umich.edu 270: 0.001: 0.01%: 0.02%: bgp973667bgs.fenkel01.mi.comcast.net 270: 0.001: 0.02%: 0.02%: edslink4.eds.com 270: 0.001: 0.02%: 0.02%: phi.towers.com 270: 0.001: 0.02%: 0.02%: bgp996826bgs.nanarb01.mi.comcast.net 270: 0.001: 0.01%: 0.02%: 12-210-102-160.client.attbi.com 269: 0.000: 0.01%: 0.02%: hwl3-dialip-174-6.dial.cac.net 269: 0.002: 0.03%: 0.02%: ip207-43.ip2go.net 269: 0.002: 0.03%: 0.02%: bgp965431bgs.derbrn01.mi.comcast.net 269: 0.001: 0.02%: 0.02%: adsl-65-43-32-158.dsl.lgtpmi.ameritech.net 269: 0.001: 0.02%: 0.02%: dhcp024-208-240-054.twmi.rr.com 268: 0.000: 0.01%: 0.02%: adsl-68-21-34-13.dsl.sfldmi.ameritech.net 268: 0.000: 0.01%: 0.02%: bgp01111035bgs.westln01.mi.comcast.net 268: 0.001: 0.03%: 0.02%: opix-240-214.stercomm.com 268: 0.001: 0.02%: 0.02%: pcp03570670pcs.wodhvn01.mi.comcast.net 267: 0.000: 0.01%: 0.02%: as09-def-mi-1-36.rasserver.net 266: 0.001: 0.02%: 0.02%: pcp01943989pcs.canton01.mi.comcast.net 266: 0.001: 0.02%: 0.02%: pcp01194337pcs.waldlk01.mi.comcast.net 266: 0.000: 0.01%: 0.02%: 12.111.232.34 266: 0.000: : 0.02%: host-92.subnet-132.med.umich.edu 266: 0.005: 0.07%: 0.02%: 66-208-224-178.ubr01a.grosep01.mi.hfc.comcastbusiness.net 266: 0.000: : 0.02%: host-24.subnet-77.med.umich.edu 266: 0.001: 0.01%: 0.02%: 65.166.146.254 265: 0.000: 0.01%: 0.02%: nic-169-c233-100.twmi.rr.com 264: 0.001: 0.02%: 0.02%: pcp01103362pcs.aubrnh01.mi.comcast.net 264: 0.002: 0.03%: 0.02%: bgp01138690bgs.ypwest01.mi.comcast.net 264: 0.001: 0.01%: 0.02%: 216.9.90.68 264: 0.004: 0.06%: 0.02%: cache-rp01.proxy.aol.com 262: 0.000: 0.01%: 0.02%: kforce-cu.kforce.com 262: 0.001: 0.02%: 0.02%: pcp02524951pcs.nromeo01.mi.comcast.net 262: 0.003: 0.04%: 0.02%: 207.148.211.155 262: 0.001: 0.01%: 0.02%: bgp01134802bgs.ypeast01.mi.comcast.net 261: 0.001: 0.02%: 0.02%: nic-29-c110-167.twmi.rr.com 261: 0.000: 0.01%: 0.02%: bgp997842bgs.nanarb01.mi.comcast.net 261: 0.000: 0.01%: 0.02%: d14-69-254-52.try.wideopenwest.com 260: 0.001: 0.02%: 0.02%: cache-mtc-ag02.proxy.aol.com 260: 0.001: 0.01%: 0.02%: 198.173.216.28 260: 0.000: : 0.02%: cache-da01.proxy.aol.com 259: 0.000: 0.01%: 0.02%: pdq.com 259: 0.001: 0.02%: 0.02%: pcp04072204pcs.sanarb01.mi.comcast.net 258: 0.001: 0.01%: 0.02%: 65-86-226-66.client.dsl.net 257: 0.001: 0.02%: 0.02%: adsl-68-74-13-136.dsl.sfldmi.ameritech.net 257: 0.001: 0.02%: 0.02%: mail.mmsm.com 257: 0.001: 0.02%: 0.02%: 165.215.88.128 257: 0.000: 0.01%: 0.02%: 69.14.111.16 257: 0.001: 0.02%: 0.02%: adsl-68-74-11-1.dsl.sfldmi.ameritech.net 256: 0.000: 0.01%: 0.02%: 63.73.224.156 256: 0.001: 0.02%: 0.02%: bgp01070211bgs.vnburn01.mi.comcast.net 256: 0.002: 0.03%: 0.02%: d60-21-249.try.wideopenwest.com 255: 0.001: 0.02%: 0.02%: d221-216-98.systems.cogeco.net 255: 0.000: 0.01%: 0.02%: bgp01136447bgs.ypwest01.mi.comcast.net 255: 0.001: 0.02%: 0.02%: h-66-134-102-174.sfldmidn.covad.net 255: 0.001: 0.02%: 0.02%: alre91h.lre.usace.army.mil 255: 0.000: 0.01%: 0.02%: pcp02695138pcs.roylok01.mi.comcast.net 254: 0.001: 0.02%: 0.02%: dialup-67.72.221.220.dial1.detroit1.level3.net 253: 0.003: 0.04%: 0.02%: timku.geo.lsa.umich.edu 253: 0.002: 0.03%: 0.02%: 64.214.200.2 253: 0.001: 0.02%: 0.02%: nt.uhs.umich.edu 253: 0.000: 0.01%: 0.02%: 65.165.95.100 253: 0.001: 0.02%: 0.02%: 12.19.128.172 253: 0.001: 0.02%: 0.02%: host-89.subnet-163.med.umich.edu 253: 0.000: : 0.02%: bgp01067645bgs.taylor01.mi.comcast.net 253: 0.000: 0.01%: 0.02%: zzz-216043191005.splitrock.net 252: 0.001: 0.03%: 0.02%: yale128036054045.student.yale.edu 252: 0.001: 0.01%: 0.02%: pcp02805779pcs.brmngh01.mi.comcast.net 252: 0.000: 0.01%: 0.02%: pcp03307512pcs.flshng01.mi.comcast.net 251: 0.001: 0.01%: 0.02%: pcp01194550pcs.waldlk01.mi.comcast.net 251: 0.001: 0.02%: 0.02%: 12.26.216.2 251: 0.001: 0.02%: 0.02%: 65.112.70.226 251: 0.001: 0.02%: 0.02%: bgp975135bgs.fenkel01.mi.comcast.net 251: 0.003: 0.04%: 0.02%: acaff-4-238.acadaff.umich.edu 250: 0.018: 0.23%: 0.02%: cr020r01-2.sac2.fastsearch.net 250: 0.002: 0.04%: 0.02%: pcp02249895pcs.gardnc01.mi.comcast.net 250: 0.000: 0.01%: 0.02%: gtw-121.nhs.uk 250: 0.000: 0.01%: 0.02%: dialup-67.72.203.237.dial1.detroit1.level3.net 250: 0.002: 0.04%: 0.02%: 167.127.107.11 249: 0.000: 0.01%: 0.02%: nic-29-c108-94.twmi.rr.com 249: 0.000: 0.01%: 0.02%: fl-teq1b1-26.pbc.adelphia.net 248: 0.001: 0.01%: 0.02%: 64.80.196.74 248: 0.000: : 0.02%: adsl-67-38-3-9.dsl.sfldmi.ameritech.net 248: 0.002: 0.03%: 0.02%: d53-149-241.try.wideopenwest.com 247: 0.000: 0.01%: 0.02%: h-68-165-57-220.chcgilgm.covad.net 247: 0.002: 0.03%: 0.02%: mailhost.uts.columbia.edu 247: 0.000: 0.01%: 0.02%: tcs-gateway11.treas.gov 246: 0.000: 0.01%: 0.02%: pm636-09.dialip.mich.net 246: 0.001: 0.01%: 0.02%: bgp01132057bgs.ypeast01.mi.comcast.net 246: 0.000: 0.01%: 0.02%: 66.227.204.156.bay.mi.chartermi.net 245: 0.001: 0.02%: 0.02%: pixd7.valueoptions.com 245: 0.000: 0.01%: 0.02%: dialup-67.72.212.124.dial1.detroit1.level3.net 245: 0.000: 0.01%: 0.02%: pcp03403065pcs.wanarb01.mi.comcast.net 245: 0.000: 0.01%: 0.02%: mpnonline.com 244: 0.000: 0.01%: 0.02%: 141.211.102.38 244: 0.002: 0.04%: 0.02%: bgp01117726bgs.westln01.mi.comcast.net 244: 0.001: 0.01%: 0.02%: 65.222.13.137 244: 0.000: 0.01%: 0.02%: unknown-167-83-101.baxter.com 243: 0.001: 0.02%: 0.02%: av-sf-micahe.bf.umich.edu 242: 0.000: 0.01%: 0.02%: 141-211-106-54.dsa.umich.edu 242: 0.000: 0.01%: 0.02%: dialup-67.72.193.103.dial1.detroit1.level3.net 242: 0.005: 0.07%: 0.02%: cache-rm08.proxy.aol.com 242: 0.002: 0.03%: 0.02%: port68.net109.bignet.net 242: 0.000: : 0.02%: ip-194.mi.verio.net 242: 0.005: 0.07%: 0.02%: 66-147-136-50.focaldata.net 241: 0.000: 0.01%: 0.02%: host-142.subnet-140.med.umich.edu 241: 0.002: 0.03%: 0.02%: adsl-67-38-2-78.dsl.sfldmi.ameritech.net 241: 0.000: 0.01%: 0.02%: 12.47.97.30 241: 0.004: 0.06%: 0.02%: cache.allina.com 241: 0.000: 0.01%: 0.02%: adsl-66-72-184-82.dsl.sfldmi.ameritech.net 240: 0.001: 0.02%: 0.02%: wan-vc8f50g.cle.biz.mindspring.com 239: 0.000: 0.01%: 0.02%: dpc6682009026.direcpc.com 239: 0.000: 0.01%: 0.02%: 0-2pool53-32.nas2.lansing2.mi.us.da.qwest.net 239: 0.000: 0.01%: 0.02%: halle107-188.emich.edu 239: 0.000: 0.01%: 0.02%: 141.211.220.245 239: 0.001: 0.02%: 0.02%: 24-56-211-198.mdmmi.voyager.net 239: 0.001: 0.01%: 0.02%: pcp03570891pcs.wodhvn01.mi.comcast.net 238: 0.001: 0.02%: 0.02%: ip199-122.ip2go.net 238: 0.002: 0.03%: 0.02%: bgp969040bgs.detrtc01.mi.comcast.net 238: 0.003: 0.04%: 0.02%: cache-mtc-ag06.proxy.aol.com 237: 0.000: 0.01%: 0.02%: 12-212-241-207.client.attbi.com 237: 0.000: 0.01%: 0.02%: hide2.wspan.com 236: 0.002: 0.04%: 0.02%: dtw-dsl214-cust131.mpowercom.net 236: 0.002: 0.03%: 0.02%: pcp04112356pcs.plyntv01.mi.comcast.net 236: 0.000: 0.01%: 0.02%: bgp977194bgs.gardnc01.mi.comcast.net 236: 0.001: 0.02%: 0.02%: 69.14.216.203 235: 0.000: 0.01%: 0.02%: 63.97.201.6 235: 0.000: 0.01%: 0.02%: psyc-denise15.psych.lsa.umich.edu 235: 0.000: 0.01%: 0.02%: dialup-67.72.224.11.dial1.detroit1.level3.net 235: 0.000: : 0.02%: 66.150.40.76 234: 0.002: 0.03%: 0.02%: dedport-136-113.idealapps.com 234: 0.002: 0.04%: 0.02%: cache-dp03.proxy.aol.com 234: 0.001: 0.02%: 0.02%: 160.129.219.104 234: 0.003: 0.05%: 0.02%: pcp01110437pcs.flint01.mi.comcast.net 233: 0.001: 0.01%: 0.02%: pcp02829132pcs.roylok01.mi.comcast.net 233: 0.000: 0.01%: 0.02%: ppp-66-73-191-195.dsl.sfldmi.ameritech.net 233: 0.000: 0.01%: 0.02%: acc1d386.ipt.aol.com 233: 0.000: 0.01%: 0.02%: cs24160101-95.houston.rr.com 232: 0.002: 0.03%: 0.02%: modem3128.net-ex.com 232: 0.000: 0.01%: 0.02%: 24.236.176.246.up.mi.chartermi.net 232: 0.001: 0.02%: 0.02%: ns1.pfizer.com 232: 0.003: 0.04%: 0.02%: pm680-18.dialip.mich.net 231: 0.000: 0.01%: 0.02%: 208.44.63.130 231: 0.000: 0.01%: 0.02%: adsl-65-42-212-86.dsl.chcgil.ameritech.net 231: 0.001: 0.03%: 0.02%: cherry8.comerica.com 231: 0.000: 0.01%: 0.02%: adsl-68-78-183-150.dsl.sfldmi.ameritech.net 230: 0.001: 0.02%: 0.02%: bgp925593bgs.brghtn01.mi.comcast.net 230: 0.001: 0.02%: 0.02%: dialup-67.72.196.177.dial1.detroit1.level3.net 230: 0.000: 0.01%: 0.02%: pcp03305164pcs.waren301.mi.comcast.net 230: 0.001: 0.02%: 0.02%: bgp01049580bgs.southg01.mi.comcast.net 230: 0.000: 0.01%: 0.02%: adsl-65-42-41-150.dsl.sfldmi.ameritech.net 230: 0.001: 0.02%: 0.02%: s00dab8.ssa.gov 229: 0.000: : 0.02%: mieastlansd058.mi.nrcs.usda.gov 229: 0.021: 0.27%: 0.02%: 195.129.103.4 229: 0.002: 0.03%: 0.02%: cache-rc03.proxy.aol.com 229: 0.002: 0.03%: 0.02%: pcp04067193pcs.sanarb01.mi.comcast.net 229: 0.000: 0.01%: 0.02%: pcp03572064pcs.wodhvn01.mi.comcast.net 229: 0.001: 0.02%: 0.02%: pcp04071351pcs.sanarb01.mi.comcast.net 229: 0.000: 0.01%: 0.02%: bgp962881bgs.derbrn01.mi.comcast.net 229: 0.002: 0.04%: 0.02%: sterlpat.trw.com 227: 0.004: 0.05%: 0.02%: pcp03307446pcs.flshng01.mi.comcast.net 227: 0.000: 0.01%: 0.02%: adsl-68-21-50-238.dsl.sfldmi.ameritech.net 227: 0.001: 0.01%: 0.02%: 64.208.215.3 227: 0.000: 0.01%: 0.02%: ouachita.engin.umich.edu 227: 0.000: : 0.02%: cache-ra01.proxy.aol.com 227: 0.000: 0.01%: 0.02%: dialup-67.72.207.61.dial1.detroit1.level3.net 227: 0.001: 0.02%: 0.02%: bgp948932bgs.canton01.mi.comcast.net 227: 0.001: 0.02%: 0.02%: d60-84-183.try.wideopenwest.com 226: 0.002: 0.03%: 0.02%: d60-8-203.try.wideopenwest.com 226: 0.000: 0.01%: 0.02%: av-sl-scanner2.bf.umich.edu 226: 0.002: 0.03%: 0.02%: cache-dl01.proxy.aol.com 226: 0.000: 0.01%: 0.02%: pcp01200880pcs.watrfd01.mi.comcast.net 226: 0.002: 0.04%: 0.02%: pcp01596609pcs.taylor01.mi.comcast.net 226: 0.003: 0.05%: 0.02%: host-217-146-9-252.warsun.com 225: 0.001: 0.02%: 0.02%: 12-245-230-34.client.attbi.com 225: 0.002: 0.03%: 0.02%: 1cust112.tnt16.det5.da.uu.net 225: 0.000: 0.01%: 0.02%: 1114107803.mi.dial.hexcom.net 225: 0.000: 0.01%: 0.02%: as12-def-mi-1-36.rasserver.net 224: 0.001: 0.02%: 0.02%: bgp996204bgs.nanarb01.mi.comcast.net 224: 0.004: 0.06%: 0.02%: cache1.speedsite.com 224: 0.000: 0.01%: 0.02%: adsl-68-73-194-109.dsl.sfldmi.ameritech.net 223: 0.000: 0.01%: 0.02%: bgp964525bgs.derbrn01.mi.comcast.net 223: 0.000: 0.01%: 0.02%: 152.160.23.1 223: 0.002: 0.03%: 0.02%: 131.107.163.46 223: 0.002: 0.03%: 0.02%: bgp01004996bgs.plyntv01.mi.comcast.net 223: 0.002: 0.03%: 0.02%: cpe-24-221-70-99.mi.sprintbbd.net 223: 0.003: 0.04%: 0.02%: crawl27.googlebot.com 223: 0.002: 0.03%: 0.02%: 192.55.140.2 222: 0.001: 0.02%: 0.02%: pcp04072887pcs.sanarb01.mi.comcast.net 222: 0.001: 0.02%: 0.02%: 211.16.225.66 222: 0.001: 0.02%: 0.02%: ipac03.aaa-autoclubgroup.com 222: 0.004: 0.06%: 0.02%: 141.217.173.118 221: 0.000: : 0.02%: 34.muia.htfd.washdctt.dsl.att.net 221: 0.000: 0.01%: 0.02%: 69.8.133.7 221: 0.001: 0.02%: 0.02%: 24.247.98.106.gha.mi.chartermi.net 221: 0.000: 0.01%: 0.02%: wellpoint-cp.bluecrossca.com 221: 0.000: 0.01%: 0.02%: pcp02968412pcs.brghtn01.mi.comcast.net 220: 0.001: 0.02%: 0.02%: adsl-67-38-25-65.dsl.sfldmi.ameritech.net 220: 0.000: 0.01%: 0.02%: pcp01800704pcs.watrfd01.mi.comcast.net 220: 0.001: 0.01%: 0.02%: adsl-68-21-33-157.dsl.sfldmi.ameritech.net 220: 0.002: 0.03%: 0.02%: host-69-21-64-197.69-21.unk.tds.net 219: 0.003: 0.04%: 0.02%: isr-126-95.isr.umich.edu 219: 0.000: 0.01%: 0.02%: 63.73.224.119 219: 0.001: 0.01%: 0.02%: dialup-67.72.196.168.dial1.detroit1.level3.net 219: 0.002: 0.03%: 0.02%: pm671-40.dialip.mich.net 219: 0.002: 0.03%: 0.02%: bgp948150bgs.canton01.mi.comcast.net 219: 0.000: 0.01%: 0.02%: bgp997369bgs.nanarb01.mi.comcast.net 218: 0.000: 0.01%: 0.02%: 24.231.178.189.bay.mi.chartermi.net 218: 0.000: 0.01%: 0.02%: cache-ra02.proxy.aol.com 218: 0.002: 0.03%: 0.02%: 141.211.99.134 218: 0.000: 0.01%: 0.02%: pcp04069474pcs.sanarb01.mi.comcast.net 218: 0.000: 0.01%: 0.02%: pcp04070914pcs.sanarb01.mi.comcast.net 217: 0.000: 0.01%: 0.02%: 1cust207.tnt1.jackson.mi.da.uu.net 217: 0.018: 0.24%: 0.02%: cr1.turnitin.com 217: 0.000: 0.01%: 0.02%: dhcp024-208-237-100.twmi.rr.com 217: 0.001: 0.01%: 0.02%: 65.90.127.222 216: 0.001: 0.02%: 0.02%: 216.45.4.91 216: 0.000: 0.01%: 0.02%: d14-69-187-148.try.wideopenwest.com 216: 0.000: 0.01%: 0.02%: 209.49.118.24 216: 0.002: 0.03%: 0.02%: 24-56-197-099.mdmmi.voyager.net 216: 0.001: 0.02%: 0.02%: 68-72-235-130.ded.ameritech.net 215: 0.001: 0.02%: 0.02%: bgp978386bgs.gardnc01.mi.comcast.net 215: 0.003: 0.05%: 0.02%: pcp03611292pcs.rocsth01.mi.comcast.net 215: 0.000: : 0.02%: 208.48.4.2 215: 0.000: 0.01%: 0.02%: 141.211.54.245 215: 0.000: : 0.02%: pm836-30.dialip.mich.net 215: 0.000: 0.01%: 0.02%: 211.72.233.19 215: 0.001: 0.02%: 0.02%: union33.ccs.itd.umich.edu 215: 0.000: 0.01%: 0.02%: bgp01138967bgs.ypwest01.mi.comcast.net 214: 0.000: 0.01%: 0.02%: 168.103.247.66 214: 0.001: 0.02%: 0.02%: imcgw1.compuware.com 214: 0.000: 0.01%: 0.02%: nic-169-c226-198.twmi.rr.com 214: 0.001: 0.02%: 0.02%: bgp926348bgs.brghtn01.mi.comcast.net 214: 0.000: 0.01%: 0.02%: edved-pc5.chem.lsa.umich.edu 214: 0.000: : 0.02%: pcp04038643pcs.wbrmfd01.mi.comcast.net 214: 0.001: 0.02%: 0.02%: 206.211.100.1 213: 0.002: 0.03%: 0.02%: pcp04072049pcs.sanarb01.mi.comcast.net 213: 0.000: 0.01%: 0.02%: ip68-107-246-39.ri.ri.cox.net 213: 0.000: 0.01%: 0.02%: bgp01064236bgs.taylor01.mi.comcast.net 213: 0.000: 0.01%: 0.02%: bgp01082007bgs.wanarb01.mi.comcast.net 213: 0.000: 0.01%: 0.02%: d60-45-159.try.wideopenwest.com 212: 0.001: 0.02%: 0.02%: cache-dq05.proxy.aol.com 212: 0.001: 0.02%: 0.02%: 208.16.183.43 212: 0.001: 0.02%: 0.02%: 152.160.4.10 212: 0.000: 0.01%: 0.02%: number87.adiaim.com 212: 0.000: 0.01%: 0.02%: 63-146-52-65.cust.qwest.net 212: 0.000: : 0.02%: pcp01113107pcs.flint01.mi.comcast.net 212: 0.000: 0.01%: 0.02%: 1cust182.tnt36.det5.da.uu.net 211: 0.001: 0.02%: 0.02%: bgp996997bgs.nanarb01.mi.comcast.net 211: 0.001: 0.02%: 0.02%: host-139.subnet-67.med.umich.edu 211: 0.000: 0.01%: 0.02%: pm519-22.dialip.mich.net 211: 0.001: 0.02%: 0.02%: 216-40-164-108.flint.tir.com 210: 0.002: 0.03%: 0.02%: 64.241.243.65 210: 0.003: 0.05%: 0.02%: 1cust28.tnt6.det3.da.uu.net 210: 0.000: 0.01%: 0.02%: px4wh.vc.shawcable.net 210: 0.000: : 0.02%: adsl-66-73-2-212.dsl.sfldmi.ameritech.net 210: 0.000: 0.01%: 0.02%: bgp01083053bgs.wanarb01.mi.comcast.net 209: 0.000: 0.01%: 0.02%: internet.cantonpl.org 209: 0.000: 0.01%: 0.02%: pcp01108433pcs.clnt3401.mi.comcast.net 209: 0.000: 0.01%: 0.02%: sunproxy.cnrf.navy.mil 209: 0.001: 0.02%: 0.02%: bgp965296bgs.derbrn01.mi.comcast.net 209: 0.000: : 0.02%: 12-210-85-172.client.attbi.com 209: 0.000: 0.01%: 0.02%: h-69-3-69-57.sfldmidn.covad.net 208: 0.011: 0.14%: 0.02%: pcp04070926pcs.sanarb01.mi.comcast.net 208: 0.001: 0.02%: 0.02%: 165.215.91.227 208: 0.001: 0.02%: 0.02%: 141-211-159-8.dent.umich.edu 208: 0.000: : 0.02%: adsl-65-43-38-80.dsl.lgtpmi.ameritech.net 208: 0.002: 0.04%: 0.02%: 12.28.112.130 208: 0.001: 0.01%: 0.02%: cache-dk03.proxy.aol.com 207: 0.001: 0.02%: 0.02%: 141.211.140.178 207: 0.000: 0.01%: 0.02%: pcp03673825pcs.grosep01.mi.comcast.net 207: 0.002: 0.03%: 0.02%: cache-mtc-al06.proxy.aol.com 207: 0.001: 0.02%: 0.02%: adsl-68-21-38-176.dsl.sfldmi.ameritech.net 207: 0.000: 0.01%: 0.02%: pcp01102384pcs.pntiac01.mi.comcast.net 207: 0.000: 0.01%: 0.02%: d53-240-139.try.wideopenwest.com 206: 0.001: 0.02%: 0.02%: pc77.caymanchem.com 206: 0.000: 0.01%: 0.02%: hr-ri-test121.bf.umich.edu 206: 0.001: 0.02%: 0.02%: dtw-dsl163-cust130.mpowercom.net 206: 0.000: 0.01%: 0.02%: adsl-67-38-4-47.dsl.sfldmi.ameritech.net 206: 0.000: : 0.02%: host-20.subnet-230.med.umich.edu 205: 0.000: 0.01%: 0.02%: bgp01000246bgs.plyntv01.mi.comcast.net 205: 0.000: 0.01%: 0.02%: bgp924466bgs.brghtn01.mi.comcast.net 205: 0.001: 0.02%: 0.02%: ppp-66-73-178-186.dsl.sfldmi.ameritech.net 205: 0.000: 0.01%: 0.02%: bgp998566bgs.nanarb01.mi.comcast.net 205: 0.002: 0.03%: 0.02%: 141.217.173.102 203: 0.000: 0.01%: 0.02%: 209.69.222.81 203: 0.001: 0.01%: 0.02%: bgp01000107bgs.plyntv01.mi.comcast.net 203: 0.000: 0.01%: 0.02%: 92.detroit-06-07rs.mi.dial-access.att.net 203: 0.001: 0.02%: 0.02%: 66-208-232-226.ubr02a.sothfd01.mi.hfc.comcastbusiness.net 203: 0.058: 0.74%: 0.02%: egspd401.teoma.com 203: 0.000: 0.01%: 0.02%: 216.89.223.56 203: 0.000: 0.01%: 0.02%: bgp924238bgs.brghtn01.mi.comcast.net 203: 0.001: 0.01%: 0.02%: bgp01050718bgs.southg01.mi.comcast.net 202: 0.001: 0.02%: 0.02%: 152.160.58.163 202: 0.000: 0.01%: 0.02%: host-105.subnet-196.med.umich.edu 202: 0.001: 0.02%: 0.02%: pcp03303360pcs.ypwest01.mi.comcast.net 202: 0.002: 0.03%: 0.02%: pcp04070860pcs.sanarb01.mi.comcast.net 202: 0.001: 0.01%: 0.02%: host-191.subnet-120.med.umich.edu 202: 0.000: : 0.02%: host-26.subnet-141.med.umich.edu 202: 0.000: : 0.02%: 204-221-175-70.ip.gvtel.com 202: 0.000: 0.01%: 0.02%: bgp966342bgs.derbrn01.mi.comcast.net 201: 0.000: : 0.02%: inktomi4-not.server.ntl.com 201: 0.001: 0.02%: 0.02%: bgp01010946bgs.rockwd01.mi.comcast.net 201: 0.000: : 0.02%: user-0c932t4.cable.mindspring.com 201: 0.001: 0.01%: 0.02%: dialup-67.72.223.96.dial1.detroit1.level3.net 201: 0.001: 0.01%: 0.02%: webproxy4.per-se.com 201: 0.000: 0.01%: 0.02%: pd9525ca4.dip.t-dialin.net 201: 0.000: 0.01%: 0.02%: user-uivfpo5.dsl.mindspring.com 200: 0.000: 0.01%: 0.02%: pm612-06.dialip.mich.net 200: 0.002: 0.03%: 0.02%: bgp01138354bgs.ypwest01.mi.comcast.net 200: 0.001: 0.01%: 0.02%: dialup-67.72.199.193.dial1.detroit1.level3.net 200: 0.001: 0.02%: 0.02%: pcp04068501pcs.sanarb01.mi.comcast.net 200: 0.001: 0.02%: 0.02%: tempdoc.uhs.umich.edu 200: 0.000: 0.01%: 0.02%: 1cust88.tnt17.det5.da.uu.net 200: 0.000: 0.01%: 0.02%: bgp969133bgs.detrtc01.mi.comcast.net 200: 0.001: 0.02%: 0.02%: 12-40-28-94.elpaso.com 200: 0.000: 0.01%: 0.02%: bgp926785bgs.brghtn01.mi.comcast.net 200: 0.000: : 0.02%: cache-da02.proxy.aol.com 200: 0.000: 0.01%: 0.02%: dhcp024-208-236-170.twmi.rr.com 200: 0.000: 0.01%: 0.02%: adsl-67-38-28-175.dsl.sfldmi.ameritech.net 199: 0.000: : 0.02%: host-133.subnet-101.med.umich.edu 199: 0.002: 0.03%: 0.02%: 198.169.127.226 199: 0.002: 0.03%: 0.02%: 141.211.226.133 199: 0.001: 0.02%: 0.02%: 63.165.216.10.bay.mi.chartermi.net 199: 0.000: 0.01%: 0.02%: 209.219.70.3 199: 0.000: 0.01%: 0.02%: pcp04149264pcs.sanarb01.mi.comcast.net 199: 0.001: 0.02%: 0.02%: d14-69-161-145.try.wideopenwest.com 199: 0.000: 0.01%: 0.02%: bgp996948bgs.nanarb01.mi.comcast.net 199: 0.002: 0.04%: 0.02%: crawl25.googlebot.com 198: 0.001: 0.02%: 0.02%: 5-pool1.ras11.misou.alerondial.net 198: 0.001: 0.02%: 0.02%: cache-mtc-ah03.proxy.aol.com 198: 0.000: 0.01%: 0.02%: nic-169-c226-58.twmi.rr.com 198: 0.002: 0.03%: 0.02%: adsl-63-207-136-19.dsl.sndg02.pacbell.net 198: 0.000: 0.01%: 0.02%: d60-181-212.try.wideopenwest.com 198: 0.000: 0.01%: 0.02%: 24.247.82.157.bay.mi.chartermi.net 198: 0.004: 0.06%: 0.02%: 159.53.238.246 198: 0.001: 0.02%: 0.02%: bgp01051585bgs.statef01.mi.comcast.net 198: 0.002: 0.03%: 0.02%: d60-13-255.try.wideopenwest.com 197: 0.002: 0.03%: 0.02%: 130.211.51.24 197: 0.000: 0.01%: 0.02%: bgp926477bgs.brghtn01.mi.comcast.net 197: 0.003: 0.04%: 0.02%: 202.88.175.136 197: 0.000: 0.01%: 0.02%: 65.106.45.186 197: 0.002: 0.03%: 0.02%: host41.orthorehabinc.com 197: 0.000: : 0.02%: adsl-66-72-176-20.dsl.sfldmi.ameritech.net 197: 0.001: 0.02%: 0.02%: wsuser200.user.cigna.com 197: 0.001: 0.01%: 0.02%: 165.215.89.206 197: 0.000: 0.01%: 0.02%: bgp01036492bgs.sothfd01.mi.comcast.net 197: 0.001: 0.01%: 0.02%: 64.9.222.11 197: 0.001: 0.02%: 0.02%: bgp935611bgs.brmngh01.mi.comcast.net 197: 0.004: 0.05%: 0.02%: cache-rh01.proxy.aol.com 197: 0.000: 0.01%: 0.02%: cache-rf06.proxy.aol.com 196: 0.001: 0.02%: 0.02%: adsl-65-42-255-154.dsl.lgtpmi.ameritech.net 196: 0.000: 0.01%: 0.02%: bgp996822bgs.nanarb01.mi.comcast.net 196: 0.000: 0.01%: 0.02%: adsl-68-20-118-233.dsl.sfldmi.ameritech.net 196: 0.001: 0.02%: 0.02%: av-ap-keeton.bf.umich.edu 196: 0.000: 0.01%: 0.02%: 168-103-154-243.dslgw3.chcg.qwest.net 196: 0.000: 0.01%: 0.02%: 216-234-103-154.ded.det2.hexcom.net 196: 0.002: 0.03%: 0.02%: 61.149.119.34 196: 0.001: 0.01%: 0.02%: internet-230a.tacom.army.mil 196: 0.003: 0.05%: 0.02%: proxy1.siemens.ca 196: 0.000: 0.01%: 0.02%: inet-fwi-a.phs.com 195: 0.002: 0.04%: 0.02%: 199.253.202.55 195: 0.001: 0.02%: 0.02%: p92.n-chpop03.stsn.com 195: 0.000: 0.01%: 0.02%: isr-207-31.isr.umich.edu 195: 0.001: 0.02%: 0.02%: 12.111.235.5 195: 0.000: 0.01%: 0.02%: sac.engin.umich.edu 195: 0.002: 0.03%: 0.02%: 61.149.114.142 195: 0.000: 0.01%: 0.02%: nic-29-c123-124.twmi.rr.com 195: 0.000: : 0.02%: bgp01082437bgs.wanarb01.mi.comcast.net 195: 0.000: 0.01%: 0.02%: pm454-44.dialip.mich.net 194: 0.003: 0.05%: 0.02%: 198.22.65.242 194: 0.000: 0.01%: 0.02%: pcp02792397pcs.roylok01.mi.comcast.net 194: 0.000: 0.01%: 0.02%: resva-igate01.trw.com 194: 0.001: 0.02%: 0.02%: 141.211.77.177 194: 0.001: 0.02%: 0.02%: pm663-37.dialip.mich.net 194: 0.000: 0.01%: 0.02%: 169.mug140.dtrt.sflmi01r1.dsl.att.net 194: 0.001: 0.02%: 0.02%: mcnat125.med.nyu.edu 194: 0.000: 0.01%: 0.02%: gateway.jabil.com 194: 0.000: : 0.02%: 141-211-157-180.dent.umich.edu 194: 0.002: 0.04%: 0.02%: 24.231.178.161.bay.mi.chartermi.net 193: 0.000: 0.01%: 0.02%: d14-69-172-52.try.wideopenwest.com 193: 0.001: 0.02%: 0.02%: 141.211.151.205 193: 0.001: 0.02%: 0.02%: pcp04068492pcs.sanarb01.mi.comcast.net 193: 0.000: 0.01%: 0.02%: d14-69-48-84.try.wideopenwest.com 193: 0.001: 0.01%: 0.02%: dialup-67.72.224.249.dial1.detroit1.level3.net 193: 0.000: 0.01%: 0.02%: cache-dc02.proxy.aol.com 192: 0.001: 0.02%: 0.02%: novgate.novacare.com 192: 0.002: 0.03%: 0.02%: p-proxy-4-int0.net.wisc.edu 192: 0.000: 0.01%: 0.02%: cache-rg03.proxy.aol.com 192: 0.001: 0.02%: 0.02%: 63.236.253.100 192: 0.001: 0.02%: 0.02%: d60-237-140.try.wideopenwest.com 192: 0.002: 0.03%: 0.02%: 207.75.154.97 192: 0.000: : 0.02%: 63.146.62.67 192: 0.002: 0.03%: 0.02%: 141-213-237-142.v-dent-arbl.umnet.umich.edu 191: 0.000: 0.01%: 0.02%: host169.206-67-110.bignet.net 191: 0.001: 0.02%: 0.02%: ip68-104-212-183.ph.ph.cox.net 191: 0.000: 0.01%: 0.02%: 134.215.215.134 191: 0.000: 0.01%: 0.02%: dialup-67.72.221.120.dial1.detroit1.level3.net 191: 0.002: 0.03%: 0.02%: dialup-67.72.202.235.dial1.detroit1.level3.net 191: 0.000: : 0.02%: 64.119.133.162 191: 0.001: 0.01%: 0.02%: 141-213-237-164.v-dent-arbl.umnet.umich.edu 191: 0.000: : 0.02%: gso167-161-010.triad.rr.com 190: 0.002: 0.03%: 0.02%: node-402406fa.sfo.onnet.us.uu.net 190: 0.000: 0.01%: 0.02%: 24.213.14.8.bay.mi.chartermi.net 190: 0.000: 0.01%: 0.02%: wwwgate1.motorola.com 190: 0.000: 0.01%: 0.02%: bgp01051400bgs.statef01.mi.comcast.net 190: 0.000: 0.01%: 0.02%: host-75.subnet-177.med.umich.edu 190: 0.000: : 0.02%: 65.116.223.35 189: 0.002: 0.03%: 0.02%: 65.201.211.130 189: 0.000: 0.01%: 0.02%: ppp-66-73-186-37.dsl.sfldmi.ameritech.net 189: 0.001: 0.02%: 0.02%: tnt02-67-21.sfld.provide.net 189: 0.001: 0.02%: 0.02%: 207.74.93.6 189: 0.000: 0.01%: 0.02%: bgp995174bgs.nanarb01.mi.comcast.net 189: 0.000: 0.01%: 0.02%: 44.detroit17rh15rt.mi.dial-access.att.net 189: 0.000: : 0.02%: adsl-065-082-218-036.sip.ags.bellsouth.net 189: 0.000: 0.01%: 0.02%: lakeport.engin.umich.edu 189: 0.000: : 0.02%: 209.176.76.14 188: 0.000: 0.01%: 0.02%: 216.45.2.219 188: 0.000: : 0.02%: 67.36.21.180 188: 0.000: 0.01%: 0.02%: 66.188.55.22.bay.mi.chartermi.net 188: 0.001: 0.02%: 0.02%: adsl-68-73-193-90.dsl.sfldmi.ameritech.net 188: 0.000: 0.01%: 0.02%: 63.236.225.250 188: 0.000: 0.01%: 0.02%: bgp998717bgs.nanarb01.mi.comcast.net 188: 0.005: 0.07%: 0.02%: novexgbri01.novacare.com 188: 0.001: 0.02%: 0.02%: 1cust158.tnt1.howell.mi.da.uu.net 187: 0.000: 0.01%: 0.02%: pcp04039688pcs.wbrmfd01.mi.comcast.net 187: 0.001: 0.02%: 0.02%: vmc.engin.umich.edu 187: 0.001: 0.02%: 0.02%: pcp03303933pcs.ypwest01.mi.comcast.net 187: 0.002: 0.03%: 0.02%: sv-fw.looksmart.com 187: 0.000: : 0.02%: cable1-243.cass.net 187: 0.001: 0.01%: 0.02%: bgp01050550bgs.southg01.mi.comcast.net 187: 0.000: 0.01%: 0.02%: 12.40.225.206 187: 0.002: 0.03%: 0.02%: 12-210-76-178.client.attbi.com 186: 0.000: 0.01%: 0.02%: 207.148.196.16 186: 0.000: 0.01%: 0.02%: cache-mtc-ab08.proxy.aol.com 186: 0.000: : 0.02%: mtl-uas-4-209197180058.3web.net 186: 0.000: 0.01%: 0.02%: dhcp106117.net.plm.eds.com 186: 0.002: 0.03%: 0.02%: washmi-pat2.trw.com 186: 0.001: 0.02%: 0.02%: isr-148-192.isr.umich.edu 186: 0.000: 0.01%: 0.02%: northwood-159-6.reshall.umich.edu 186: 0.000: 0.01%: 0.02%: metamora.engin.umich.edu 186: 0.002: 0.03%: 0.02%: ip68-100-56-184.nv.nv.cox.net 186: 0.000: 0.01%: 0.02%: bgp930699bgs.brmngh01.mi.comcast.net 186: 0.002: 0.03%: 0.02%: 198.109.205.253 185: 0.001: 0.01%: 0.02%: gate02c.merckmedco.com 185: 0.001: 0.02%: 0.02%: host115.pittsfieldtwp.org 185: 0.002: 0.03%: 0.02%: 129.9.163.234 185: 0.000: 0.01%: 0.02%: host-166.subnet-193.med.umich.edu 185: 0.000: 0.01%: 0.02%: cache-rg04.proxy.aol.com 185: 0.000: 0.01%: 0.02%: nic-29-c123-219.twmi.rr.com 185: 0.000: 0.01%: 0.02%: unknown.waukesha.tec.wi.us 185: 0.001: 0.01%: 0.02%: dialup-67.72.203.73.dial1.detroit1.level3.net 185: 0.000: : 0.02%: cache-mtc-ac07.proxy.aol.com 185: 0.000: 0.01%: 0.02%: pcp01925238pcs.canton01.mi.comcast.net 185: 0.000: 0.01%: 0.02%: 63.162.24.193 185: 0.000: 0.01%: 0.02%: cache-dg06.proxy.aol.com 185: 0.000: 0.01%: 0.02%: netcache-2002.public.lawson.webtv.net 184: 0.000: 0.01%: 0.02%: hr-sp-cjwhite.bf.umich.edu 184: 0.000: : 0.02%: eks-05.metro.louisville.edu 184: 0.000: 0.01%: 0.02%: nic-169-c237-75.twmi.rr.com 184: 0.000: : 0.02%: cpe-24-162-221-74.elp.rr.com 184: 0.003: 0.04%: 0.02%: trek14.sv.av.com 184: 0.000: : 0.02%: host-168.subnet-22.med.umich.edu 184: 0.000: 0.01%: 0.02%: isr-146-34.isr.umich.edu 184: 0.001: 0.02%: 0.02%: 74-205-112-64.dialup.tc3net.com 184: 0.003: 0.04%: 0.02%: pcp04180303pcs.macmb101.mi.comcast.net 184: 0.000: 0.01%: 0.02%: nic-29-c98-188.twmi.rr.com 184: 0.000: 0.01%: 0.02%: client1.vw.com 184: 0.001: 0.02%: 0.02%: 66-147-136-218.focaldata.net 184: 0.000: 0.01%: 0.02%: dialup-209.244.88.204.dial1.detroit1.level3.net 183: 0.000: 0.01%: 0.02%: 146.142.162.8 183: 0.000: 0.01%: 0.02%: bgp01132708bgs.ypeast01.mi.comcast.net 183: 0.002: 0.04%: 0.02%: gateway240.dcaa.mil 183: 0.002: 0.03%: 0.02%: 66.227.205.76.bay.mi.chartermi.net 183: 0.001: 0.01%: 0.02%: pcp02122659pcs.waldlk01.mi.comcast.net 183: 0.000: 0.01%: 0.02%: burtlake.engin.umich.edu 183: 0.001: 0.02%: 0.02%: sdn-ap-008ilchicp0422.dialsprint.net 183: 0.000: 0.01%: 0.02%: avlint.avlna.com 183: 0.003: 0.05%: 0.02%: 141.215.64.195 183: 0.002: 0.03%: 0.02%: sdn-ap-030ilchicp0276.dialsprint.net 182: 0.000: 0.01%: 0.02%: 167.206.189.62 182: 0.001: 0.02%: 0.02%: ppp-66-73-178-86.dsl.sfldmi.ameritech.net 182: 0.001: 0.02%: 0.02%: pcp04070790pcs.sanarb01.mi.comcast.net 182: 0.000: : 0.02%: 141.211.103.43 182: 0.000: 0.01%: 0.02%: d14-69-147-106.try.wideopenwest.com 182: 0.000: 0.01%: 0.02%: 165.215.90.174 182: 0.000: 0.01%: 0.02%: 209.69.36.76 182: 0.000: 0.01%: 0.02%: 05-096.114.popsite.net 182: 0.000: 0.01%: 0.02%: user-10ibb54.biz.mindspring.com 181: 0.000: 0.01%: 0.02%: 167.206.189.16 181: 0.000: 0.01%: 0.02%: mmtc-gw.mmtc.org 181: 0.000: 0.01%: 0.02%: d163.as3.lnng.mi.voyager.net 181: 0.000: : 0.02%: adsl-80-200-44.rdu.bellsouth.net 181: 0.000: 0.01%: 0.02%: adsl-68-74-3-94.dsl.sfldmi.ameritech.net 181: 0.000: : 0.02%: cache-df07.proxy.aol.com 181: 0.000: 0.01%: 0.02%: d164.as0.jcsn.mi.voyager.net 181: 0.001: 0.01%: 0.02%: 159.53.32.46 180: 0.000: 0.01%: 0.02%: pcp01925369pcs.canton01.mi.comcast.net 180: 0.000: 0.01%: 0.02%: httpproxy.clear.net.nz 180: 0.000: 0.01%: 0.02%: 66.227.253.203.bay.mi.chartermi.net 180: 0.002: 0.03%: 0.02%: dialup-67.72.216.1.dial1.detroit1.level3.net 180: 0.000: 0.01%: 0.02%: bgp965788bgs.derbrn01.mi.comcast.net 180: 0.000: 0.01%: 0.02%: bgp964241bgs.derbrn01.mi.comcast.net 180: 0.001: 0.02%: 0.02%: pcp04072107pcs.sanarb01.mi.comcast.net 180: 0.002: 0.03%: 0.02%: adsl-67-37-204-134.dsl.chcgil.ameritech.net 179: 0.001: 0.02%: 0.02%: ti-to-markjk.bf.umich.edu 179: 0.000: 0.01%: 0.02%: pcp03673565pcs.grosep01.mi.comcast.net 179: 0.000: 0.01%: 0.02%: ckcfpxy1.att.com 179: 0.000: 0.01%: 0.02%: dedport-141-206.idealapps.com 179: 0.000: 0.01%: 0.02%: pixd2.valueoptions.com 178: 0.001: 0.02%: 0.02%: 12.37.92.137 178: 0.002: 0.03%: 0.02%: cache-rk08.proxy.aol.com 178: 0.000: 0.01%: 0.02%: adsl-68-21-32-110.dsl.sfldmi.ameritech.net 178: 0.000: 0.01%: 0.02%: farmipat.trw.com 177: 0.001: 0.02%: 0.02%: tan7.ncr.com 177: 0.000: 0.01%: 0.02%: 208.54.198.4 177: 0.000: 0.01%: 0.02%: 65.209.233.63 177: 0.000: 0.01%: 0.02%: sdn-ap-009ilchicp0259.dialsprint.net 177: 0.001: 0.02%: 0.02%: 63.146.32.82 177: 0.000: 0.01%: 0.02%: pm481-03.dialip.mich.net 177: 0.000: : 0.02%: usr34-308.provide.net 177: 0.000: : 0.02%: bgp927623bgs.brghtn01.mi.comcast.net 176: 0.000: : 0.02%: 207.148.197.183 176: 0.000: 0.01%: 0.02%: pcp02621055pcs.watrfd01.mi.comcast.net 176: 0.000: 0.01%: 0.02%: combi.engin.umich.edu 176: 0.000: 0.01%: 0.02%: cache-rc01.proxy.aol.com 176: 0.000: : 0.02%: pm636-00.dialip.mich.net 176: 0.001: 0.02%: 0.02%: adsl-68-73-195-128.dsl.sfldmi.ameritech.net 176: 0.000: : 0.02%: usr34-354.provide.net 176: 0.000: : 0.02%: jordand.personal.engin.umich.edu 176: 0.000: : 0.02%: adsl-68-74-28-69.dsl.sfldmi.ameritech.net 176: 0.000: 0.01%: 0.02%: 63.99.119.20 176: 0.000: 0.01%: 0.02%: 141.213.137.60 176: 0.002: 0.03%: 0.02%: d14-69-38-153.try.wideopenwest.com 176: 0.001: 0.02%: 0.02%: d60-125-211.try.wideopenwest.com 175: 0.000: 0.01%: 0.01%: adsl-67-38-11-30.dsl.sfldmi.ameritech.net 175: 0.001: 0.01%: 0.01%: stewie.lottery.com 175: 0.000: 0.01%: 0.01%: host-152.subnet-195.med.umich.edu 175: 0.000: : 0.01%: 12-245-208-60.client.attbi.com 175: 0.000: : 0.01%: ppp1-41.ros.cooketech.net 175: 0.002: 0.03%: 0.01%: pcp01944164pcs.canton01.mi.comcast.net 175: 0.001: 0.01%: 0.01%: 0-1pool110-121.nas12.pittsfield-township2.mi.us.da.qwest.net 175: 0.001: 0.02%: 0.01%: cache-rr03.proxy.aol.com 174: 0.003: 0.04%: 0.01%: 141-211-157-6.dent.umich.edu 174: 0.000: 0.01%: 0.01%: 207.179.85.167 174: 0.001: 0.01%: 0.01%: 233-pool1.ras10.misou.alerondial.net 174: 0.001: 0.02%: 0.01%: 12-212-242-130.client.attbi.com 174: 0.000: : 0.01%: 204.211.245.158 174: 0.000: 0.01%: 0.01%: 46-pool2.ras10.misou.alerondial.net 173: 0.000: 0.01%: 0.01%: 64-145-139-34.client.dsl.net 173: 0.002: 0.03%: 0.01%: wcs2-mcpherson.nipr.mil 173: 0.000: 0.01%: 0.01%: bgp01132613bgs.ypeast01.mi.comcast.net 173: 0.000: 0.01%: 0.01%: 63.149.74.131 173: 0.001: 0.02%: 0.01%: 69.39.71.81 173: 0.000: : 0.01%: dtw-dsl161-cust022.mpowercom.net 173: 0.000: 0.01%: 0.01%: bgp01060711bgs.taylor01.mi.comcast.net 173: 0.000: 0.01%: 0.01%: reception.psych.lsa.umich.edu 173: 0.000: 0.01%: 0.01%: bgp01033653bgs.sothfd01.mi.comcast.net 172: 0.002: 0.03%: 0.01%: w7p.aetna.com 172: 0.000: 0.01%: 0.01%: dtw-dsl213-cust176.mpowercom.net 172: 0.000: 0.01%: 0.01%: px4so.cg.shawcable.net 172: 0.000: 0.01%: 0.01%: pcp04172605pcs.macmb101.mi.comcast.net 172: 0.000: 0.01%: 0.01%: 210.195.144.87 172: 0.000: 0.01%: 0.01%: d53-231-237.try.wideopenwest.com 172: 0.000: 0.01%: 0.01%: 217.29.140.15 172: 0.000: 0.01%: 0.01%: 67-37-213-65.maps-na.com 171: 0.000: 0.01%: 0.01%: pcp02399684pcs.flint01.mi.comcast.net 171: 0.000: : 0.01%: 24-56-201-123.mdmmi.voyager.net 171: 0.000: : 0.01%: 64-202-4-4.sfoca11.sfo.ufoix.com 171: 0.000: 0.01%: 0.01%: fierke-pc2.chem.lsa.umich.edu 171: 0.000: 0.01%: 0.01%: pcp04149571pcs.sanarb01.mi.comcast.net 171: 0.000: 0.01%: 0.01%: l98uppx1.hewitt.com 171: 0.001: 0.02%: 0.01%: 12.40.225.2 171: 0.001: 0.02%: 0.01%: bgp01007239bgs.plyntv01.mi.comcast.net 171: 0.000: 0.01%: 0.01%: 12.20.110.151 171: 0.000: : 0.01%: cache-rb06.proxy.aol.com 170: 0.000: 0.01%: 0.01%: pcp01116212pcs.flint01.mi.comcast.net 170: 0.000: : 0.01%: pcp02255933pcs.wanarb01.mi.comcast.net 170: 0.001: 0.02%: 0.01%: d14-69-161-157.try.wideopenwest.com 170: 0.000: 0.01%: 0.01%: bgp930853bgs.brmngh01.mi.comcast.net 170: 0.000: 0.01%: 0.01%: bgp963735bgs.derbrn01.mi.comcast.net 170: 0.000: 0.01%: 0.01%: ho-node2.gmacm.com 170: 0.000: 0.01%: 0.01%: pu-ap-lollylee.bf.umich.edu 170: 0.001: 0.02%: 0.01%: mail.captec.com 169: 0.000: 0.01%: 0.01%: c-67-162-211-49.client.comcast.net 169: 0.000: 0.01%: 0.01%: cache-df08.proxy.aol.com 169: 0.000: 0.01%: 0.01%: cache-rk06.proxy.aol.com 169: 0.000: 0.01%: 0.01%: aadhcp6-92.aa.hcia.com 169: 0.000: 0.01%: 0.01%: 1cust209.tnt1.temperance.mi.da.uu.net 169: 0.002: 0.03%: 0.01%: cflo-ext.basf-corp.com 169: 0.001: 0.01%: 0.01%: hist550693.history.lsa.umich.edu 169: 0.000: 0.01%: 0.01%: h-64-105-217-22.sfldmidn.covad.net 168: 0.000: 0.01%: 0.01%: bgp01131189bgs.ypeast01.mi.comcast.net 168: 0.000: 0.01%: 0.01%: server.farragut.k12.ia.us 168: 0.000: : 0.01%: 12-212-220-167.client.attbi.com 168: 0.000: 0.01%: 0.01%: pcp02256203pcs.wanarb01.mi.comcast.net 168: 0.001: 0.02%: 0.01%: bgp994047bgs.nanarb01.mi.comcast.net 168: 0.003: 0.05%: 0.01%: 141.215.10.97 168: 0.001: 0.02%: 0.01%: bgp936335bgs.brmngh01.mi.comcast.net 167: 0.000: 0.01%: 0.01%: 64.3.234.122 167: 0.000: 0.01%: 0.01%: 12.31.60.60 167: 0.000: 0.01%: 0.01%: gateway2.uscg.mil 167: 0.000: 0.01%: 0.01%: 216.99.65.8 167: 0.001: 0.02%: 0.01%: adsl-67-38-18-94.dsl.sfldmi.ameritech.net 167: 0.000: 0.01%: 0.01%: bgp01131490bgs.ypeast01.mi.comcast.net 167: 0.000: 0.01%: 0.01%: zzz-209253096186.splitrock.net 167: 0.000: 0.01%: 0.01%: 193.51.104.59 167: 0.000: 0.01%: 0.01%: 12.145.192.117 166: 0.000: : 0.01%: 141-211-137-128.dev.umich.edu 166: 0.000: 0.01%: 0.01%: 12-245-255-52.client.attbi.com 166: 0.000: 0.01%: 0.01%: bgp995610bgs.nanarb01.mi.comcast.net 166: 0.000: : 0.01%: adsl-63-182-53.ilm.bellsouth.net 166: 0.000: 0.01%: 0.01%: cache-mtc-am03.proxy.aol.com 166: 0.000: : 0.01%: pm478-38.dialip.mich.net 166: 0.000: 0.01%: 0.01%: d60-90-194.try.wideopenwest.com 166: 0.002: 0.03%: 0.01%: d60-118-241.try.wideopenwest.com 166: 0.001: 0.01%: 0.01%: cache-dc05.proxy.aol.com 166: 0.001: 0.02%: 0.01%: pc1621.sph.umich.edu 166: 0.001: 0.02%: 0.01%: cache-rl07.proxy.aol.com 165: 0.000: 0.01%: 0.01%: pcp01152634pcs.newhav01.mi.comcast.net 165: 0.000: : 0.01%: 3639246778.mi.dial.hexcom.net 165: 0.000: : 0.01%: nap1.corp.cat.com 165: 0.000: 0.01%: 0.01%: 192.35.79.70 165: 0.000: 0.01%: 0.01%: atcs9.ccs.itd.umich.edu 165: 0.000: : 0.01%: adsl-68-21-38-72.dsl.sfldmi.ameritech.net 165: 0.001: 0.02%: 0.01%: filmbzn8c21.dhcp.lsa.umich.edu 165: 0.000: 0.01%: 0.01%: pcp03571202pcs.wodhvn01.mi.comcast.net 164: 0.000: 0.01%: 0.01%: bgp955989bgs.chndlr01.mi.comcast.net 164: 0.000: 0.01%: 0.01%: pcp03402892pcs.wanarb01.mi.comcast.net 164: 0.003: 0.04%: 0.01%: cache-mtc-ah06.proxy.aol.com 164: 0.000: 0.01%: 0.01%: 64.30.211.213.lcinet.net 164: 0.001: 0.02%: 0.01%: 152.160.121.210 164: 0.000: 0.01%: 0.01%: host172.admn.oakland.edu 164: 0.000: : 0.01%: d95.as0.ondg.mi.voyager.net 164: 0.000: : 0.01%: d67.as0.flnt.mi.voyager.net 164: 0.000: 0.01%: 0.01%: pm682-26.dialip.mich.net 164: 0.000: 0.01%: 0.01%: bgp941646bgs.canton01.mi.comcast.net 164: 0.000: 0.01%: 0.01%: 66.100.211.98 164: 0.000: 0.01%: 0.01%: h0000b4c2c48d.ne.client2.attbi.com 164: 0.001: 0.02%: 0.01%: ppp-66-73-177-148.dsl.sfldmi.ameritech.net 164: 0.003: 0.05%: 0.01%: 68-72-228-67.ded.ameritech.net 164: 0.000: 0.01%: 0.01%: 12-237-221-16.client.attbi.com 164: 0.001: 0.02%: 0.01%: 63-208-160-66.digirealm.com 163: 0.002: 0.03%: 0.01%: bgp928259bgs.brghtn01.mi.comcast.net 163: 0.001: 0.02%: 0.01%: pcp03224967pcs.wanarb01.mi.comcast.net 163: 0.000: 0.01%: 0.01%: d53-176-164.try.wideopenwest.com 163: 0.001: 0.02%: 0.01%: 141.211.218.55 163: 0.000: 0.01%: 0.01%: d14-69-87-150.try.wideopenwest.com 163: 0.000: 0.01%: 0.01%: palo4.pacific.net.sg 163: 0.000: : 0.01%: h24-70-78-227.ed.shawcable.net 163: 0.000: 0.01%: 0.01%: av-sp-starret.bf.umich.edu 163: 0.000: 0.01%: 0.01%: pcp04070834pcs.sanarb01.mi.comcast.net 163: 0.000: : 0.01%: pat.pseg.com 163: 0.000: 0.01%: 0.01%: d53-208-235.try.wideopenwest.com 162: 0.000: 0.01%: 0.01%: adsl-66-73-9-116.dsl.sfldmi.ameritech.net 162: 0.000: 0.01%: 0.01%: node1.allegiance.net 162: 0.000: 0.01%: 0.01%: kpcrdc.kp.org 162: 0.001: 0.01%: 0.01%: wg.borgess.com 162: 0.000: 0.01%: 0.01%: 12.27.0.193 162: 0.000: 0.01%: 0.01%: bgp01116574bgs.westln01.mi.comcast.net 162: 0.000: 0.01%: 0.01%: ygparker.eecs.umich.edu 162: 0.002: 0.03%: 0.01%: seg-collagan.engin.umich.edu 162: 0.000: 0.01%: 0.01%: user-2injlhq.dialup.mindspring.com 162: 0.001: 0.01%: 0.01%: pcp02842642pcs.roylok01.mi.comcast.net 162: 0.000: 0.01%: 0.01%: 65.89.230.130 161: 0.000: : 0.01%: psyc-chr01.psych.lsa.umich.edu 161: 0.001: 0.02%: 0.01%: bgp999025bgs.nanarb01.mi.comcast.net 161: 0.001: 0.01%: 0.01%: bgp948216bgs.canton01.mi.comcast.net 161: 0.001: 0.02%: 0.01%: dhcp024-208-239-065.twmi.rr.com 161: 0.000: 0.01%: 0.01%: 216.255.22.123 161: 0.006: 0.08%: 0.01%: cache-rm03.proxy.aol.com 161: 0.000: 0.01%: 0.01%: 1cust166.tnt1.howell.mi.da.uu.net 161: 0.001: 0.02%: 0.01%: 12.40.225.171 161: 0.001: 0.01%: 0.01%: adsl-68-22-235-241.dsl.lgtpmi.ameritech.net 161: 0.003: 0.04%: 0.01%: cache-mtc-ag01.proxy.aol.com 161: 0.000: 0.01%: 0.01%: nfld040088.net.hfh.edu 161: 0.000: 0.01%: 0.01%: pcp03573883pcs.wodhvn01.mi.comcast.net 161: 0.000: 0.01%: 0.01%: 68.20.104.201 160: 0.000: 0.01%: 0.01%: 24.247.160.46.bay.mi.chartermi.net 160: 0.001: 0.01%: 0.01%: bgp01059565bgs.taylor01.mi.comcast.net 160: 0.000: 0.01%: 0.01%: us1.pharmacia.com 160: 0.000: 0.01%: 0.01%: 141-211-90-60.dsa.umich.edu 160: 0.000: 0.01%: 0.01%: d14-69-47-217.try.wideopenwest.com 160: 0.002: 0.03%: 0.01%: adsl-247-21.ns.itd.umich.edu 160: 0.001: 0.01%: 0.01%: 199.43.176.12 159: 0.001: 0.02%: 0.01%: host-76.subnet-72.med.umich.edu 159: 0.000: 0.01%: 0.01%: dsldhcp4-127.greenmountainaccess.net 159: 0.000: : 0.01%: 12.20.111.31 159: 0.000: 0.01%: 0.01%: 141.213.136.118 159: 0.000: 0.01%: 0.01%: tnt02-66-79.sfld.provide.net 159: 0.000: 0.01%: 0.01%: 217.10.167.112 158: 0.001: 0.02%: 0.01%: av-ap-hbolster.bf.umich.edu 158: 0.001: 0.01%: 0.01%: wwwgate13.motorola.com 158: 0.000: 0.01%: 0.01%: pcp04232156pcs.plyntv01.mi.comcast.net 158: 0.000: 0.01%: 0.01%: dtw-dsl161-cust116.mpowercom.net 158: 0.000: 0.01%: 0.01%: 146.82.36.102 158: 0.000: 0.01%: 0.01%: adsl-67-38-77-78.dsl.sfldmi.ameritech.net 158: 0.000: 0.01%: 0.01%: st-cs-171mb11.bf.umich.edu 158: 0.000: 0.01%: 0.01%: 12.144.36.2 158: 0.001: 0.02%: 0.01%: bgp960672bgs.derbrh01.mi.comcast.net 158: 0.001: 0.03%: 0.01%: d60-176-239.try.wideopenwest.com 158: 0.000: 0.01%: 0.01%: pcp02690530pcs.roylok01.mi.comcast.net 158: 0.002: 0.03%: 0.01%: d60-136-249.try.wideopenwest.com 158: 0.000: 0.01%: 0.01%: pcp04069215pcs.sanarb01.mi.comcast.net 157: 0.000: 0.01%: 0.01%: 12-245-173-32.client.attbi.com 157: 0.000: 0.01%: 0.01%: 207.74.200.72 157: 0.001: 0.02%: 0.01%: 66.73.236.66 157: 0.004: 0.05%: 0.01%: enduser5.faa.gov 157: 0.000: 0.01%: 0.01%: 0-1pool88-80.nas6.lansing2.mi.us.da.qwest.net 157: 0.000: : 0.01%: d60-146-237.try.wideopenwest.com 157: 0.000: 0.01%: 0.01%: d53-102-226.try.wideopenwest.com 157: 0.001: 0.02%: 0.01%: adsl-155-192-20.asm.bellsouth.net 157: 0.002: 0.04%: 0.01%: cache-rk05.proxy.aol.com 157: 0.002: 0.03%: 0.01%: unknown.level3.net 157: 0.000: 0.01%: 0.01%: bgp994166bgs.nanarb01.mi.comcast.net 157: 0.001: 0.02%: 0.01%: nic-29-c126-1.twmi.rr.com 157: 0.000: 0.01%: 0.01%: eof2.engin.umich.edu 157: 0.000: 0.01%: 0.01%: sswd2edrs.dhcp.lsa.umich.edu 157: 0.001: 0.02%: 0.01%: 67.36.224.139 157: 0.001: 0.01%: 0.01%: 128-pool2.ras10.misou.alerondial.net 156: 0.001: 0.01%: 0.01%: cache02.lax.untd.com 156: 0.000: 0.01%: 0.01%: delta.minnesotamutual.com 156: 0.000: : 0.01%: webcacheb13a.cache.pol.co.uk 156: 0.000: 0.01%: 0.01%: pcp01944894pcs.canton01.mi.comcast.net 156: 0.000: 0.01%: 0.01%: adsl-68-73-193-135.dsl.sfldmi.ameritech.net 156: 0.001: 0.02%: 0.01%: 207.148.195.177 156: 0.000: 0.01%: 0.01%: bgp01016234bgs.rosvle01.mi.comcast.net 156: 0.000: 0.01%: 0.01%: cache-mtc-aa01.proxy.aol.com 156: 0.001: 0.01%: 0.01%: cache-mtc-aa09.proxy.aol.com 156: 0.000: 0.01%: 0.01%: user-2injkej.dialup.mindspring.com 156: 0.000: 0.01%: 0.01%: reverse.196.146.118.64.idealapps.com 156: 0.000: 0.01%: 0.01%: d60-126-215.try.wideopenwest.com 156: 0.003: 0.04%: 0.01%: cache-dk10.proxy.aol.com 155: 0.002: 0.03%: 0.01%: bgp953807bgs.canton01.mi.comcast.net 155: 0.001: 0.01%: 0.01%: bgp962884bgs.derbrn01.mi.comcast.net 155: 0.000: 0.01%: 0.01%: pcp03151546pcs.rocsth01.mi.comcast.net 155: 0.002: 0.03%: 0.01%: bgp956837bgs.derbrh01.mi.comcast.net 155: 0.000: 0.01%: 0.01%: w008.z064001084.det-mi.dsl.cnc.net 155: 0.000: : 0.01%: host-149.subnet-30.med.umich.edu 155: 0.000: 0.01%: 0.01%: 139.134.63.153 155: 0.000: 0.01%: 0.01%: bgp928624bgs.brghtn01.mi.comcast.net 155: 0.000: 0.01%: 0.01%: 66.188.59.32.bay.mi.chartermi.net 154: 0.001: 0.02%: 0.01%: 216.93.50.81 154: 0.000: 0.01%: 0.01%: w146.z064001087.bos-ma.dsl.cnc.net 154: 0.002: 0.03%: 0.01%: bgp997924bgs.nanarb01.mi.comcast.net 154: 0.002: 0.03%: 0.01%: gwa.fh.us.bosch.com 154: 0.002: 0.03%: 0.01%: cache-dh07.proxy.aol.com 154: 0.000: 0.01%: 0.01%: bgp945874bgs.canton01.mi.comcast.net 154: 0.001: 0.02%: 0.01%: 199.150.139.190 153: 0.001: 0.02%: 0.01%: dhcp081.glerl.noaa.gov 153: 0.000: 0.01%: 0.01%: lucy.childrenshc.org 153: 0.003: 0.04%: 0.01%: 12.154.162.2 153: 0.000: 0.01%: 0.01%: unknown.iog.umich.edu 153: 0.000: 0.01%: 0.01%: leopard1.arbor.edu 153: 0.001: 0.02%: 0.01%: pcp04058463pcs.wbrmfd01.mi.comcast.net 153: 0.000: 0.01%: 0.01%: 168-215-102-189.cdphp.com 153: 0.000: 0.01%: 0.01%: mail.genpackaging.com 153: 0.000: 0.01%: 0.01%: as02-def-mi-1-168.rasserver.net 153: 0.000: 0.01%: 0.01%: du79sag-mi.diamondcs.net 153: 0.000: 0.01%: 0.01%: reverse.90.x.118.64.idealapps.com 153: 0.000: 0.01%: 0.01%: bgp997041bgs.nanarb01.mi.comcast.net 153: 0.000: 0.01%: 0.01%: 216.11.88.211 152: 0.000: 0.01%: 0.01%: 207.148.197.155 152: 0.000: : 0.01%: adsl-68-21-46-147.dsl.sfldmi.ameritech.net 152: 0.000: 0.01%: 0.01%: user-1120e4s.dsl.mindspring.com 152: 0.004: 0.06%: 0.01%: ohcol1zc01.aon.com 152: 0.002: 0.03%: 0.01%: pcp01112939pcs.flint01.mi.comcast.net 152: 0.000: : 0.01%: 204.39.106.197 152: 0.001: 0.02%: 0.01%: pe-bo-sbrowne.bf.umich.edu 152: 0.001: 0.01%: 0.01%: primary-206-185-64-host2.thoughtport.com 152: 0.000: 0.01%: 0.01%: e02.proxy.fedex.com 152: 0.000: 0.01%: 0.01%: unknown.sagonet.net 152: 0.000: 0.01%: 0.01%: adsl-67-38-27-42.dsl.sfldmi.ameritech.net 151: 0.003: 0.05%: 0.01%: pcp04070298pcs.sanarb01.mi.comcast.net 151: 0.000: 0.01%: 0.01%: 141-213-236-184.ns.itd.umich.edu 151: 0.001: 0.01%: 0.01%: 96-199-112-64.dialup.tc3net.com 151: 0.000: 0.01%: 0.01%: d60-89-213.try.wideopenwest.com 151: 0.000: 0.01%: 0.01%: unallocated.star.net.uk 151: 0.000: 0.01%: 0.01%: as09-def-mi-1-123.rasserver.net 151: 0.001: 0.02%: 0.01%: cache-mtc-ac01.proxy.aol.com 151: 0.000: 0.01%: 0.01%: dialup-67.72.207.164.dial1.detroit1.level3.net 151: 0.000: 0.01%: 0.01%: pcp02853510pcs.roylok01.mi.comcast.net 151: 0.000: : 0.01%: 207.75.157.20 151: 0.001: 0.02%: 0.01%: pm663-34.dialip.mich.net 151: 0.000: : 0.01%: as03-roc-mn-1-5.rasserver.net 150: 0.000: 0.01%: 0.01%: wuom3.wuom.univrel.umich.edu 150: 0.000: 0.01%: 0.01%: ppp-66-73-187-149.dsl.sfldmi.ameritech.net 150: 0.002: 0.03%: 0.01%: pcp02995960pcs.stclar01.mi.comcast.net 150: 0.002: 0.03%: 0.01%: bgp966412bgs.derbrn01.mi.comcast.net 150: 0.001: 0.02%: 0.01%: cache-mtc-ab05.proxy.aol.com 150: 0.000: 0.01%: 0.01%: pm527-07.dialip.mich.net 150: 0.000: 0.01%: 0.01%: ip64-178-59-118.z59-178-64.customer.algx.net 150: 0.000: 0.01%: 0.01%: 100.mercerville-36-37rs.nj.dial-access.att.net 150: 0.001: 0.02%: 0.01%: 198.2.12.11 150: 0.000: 0.01%: 0.01%: 12.148.36.131 150: 0.000: : 0.01%: 1cust241.tnt9.det5.da.uu.net 150: 0.000: 0.01%: 0.01%: pcp01800487pcs.watrfd01.mi.comcast.net 150: 0.000: : 0.01%: 206.180.153.171.adsl.hal-pc.org 150: 0.002: 0.03%: 0.01%: pcp01939788pcs.waldlk01.mi.comcast.net 150: 0.000: 0.01%: 0.01%: 67.17.200.172 150: 0.000: : 0.01%: pc34.caymanchem.com 150: 0.000: 0.01%: 0.01%: 141.211.130.72 149: 0.000: 0.01%: 0.01%: bgp994388bgs.nanarb01.mi.comcast.net 149: 0.000: 0.01%: 0.01%: d131.as0.trcy.mi.voyager.net 149: 0.000: 0.01%: 0.01%: dhcp31164084.columbus.rr.com 149: 0.000: 0.01%: 0.01%: ccbfast.ic.net 149: 0.000: 0.01%: 0.01%: 207.179.79.136 149: 0.000: 0.01%: 0.01%: pcp04027222pcs.wanarb01.mi.comcast.net 149: 0.000: 0.01%: 0.01%: 199.132.105.16 149: 0.000: 0.01%: 0.01%: 63-70-31-5.cfginsurance.com 149: 0.000: : 0.01%: kalamazoo2.groupmarketingservices.com 149: 0.002: 0.03%: 0.01%: 209.69.38.4 149: 0.001: 0.02%: 0.01%: ppp-66-73-189-185.dsl.sfldmi.ameritech.net 149: 0.000: 0.01%: 0.01%: 69.14.207.201 149: 0.000: 0.01%: 0.01%: njproxy5.avaya.com 149: 0.001: 0.01%: 0.01%: cache-mtc-am07.proxy.aol.com 149: 0.000: 0.01%: 0.01%: fx.imagemaster.com 149: 0.000: 0.01%: 0.01%: downs.kines.umich.edu 149: 0.001: 0.01%: 0.01%: host-76.subnet-194.med.umich.edu 149: 0.000: 0.01%: 0.01%: 12.165.161.2 148: 0.000: : 0.01%: 66.227.159.10.bay.mi.chartermi.net 148: 0.000: : 0.01%: northwood-158-178.reshall.umich.edu 148: 0.000: 0.01%: 0.01%: cache-ra03.proxy.aol.com 148: 0.000: 0.01%: 0.01%: 167.219.32.11 148: 0.000: 0.01%: 0.01%: dean-05.com.msu.edu 148: 0.000: : 0.01%: bgp01133635bgs.ypeast01.mi.comcast.net 148: 0.000: 0.01%: 0.01%: pcp02110765pcs.newhav01.mi.comcast.net 148: 0.000: 0.01%: 0.01%: 12.20.132.21 148: 0.000: 0.01%: 0.01%: 69.14.49.205 147: 0.001: 0.03%: 0.01%: pcp04085716pcs.wbrmfd01.mi.comcast.net 147: 0.000: : 0.01%: dialup-67.72.212.160.dial1.detroit1.level3.net 147: 0.000: 0.01%: 0.01%: netcache-2004.public.lawson.webtv.net 147: 0.000: 0.01%: 0.01%: akcf3-ggi.xtra.co.nz 147: 0.000: 0.01%: 0.01%: 68-75-217-24.ded.ameritech.net 147: 0.000: 0.01%: 0.01%: bgp01080112bgs.wanarb01.mi.comcast.net 147: 0.002: 0.03%: 0.01%: cache-db05.proxy.aol.com 147: 0.000: 0.01%: 0.01%: geoaklaue.geo.lsa.umich.edu 147: 0.000: 0.01%: 0.01%: netcache-2003.public.lawson.webtv.net 147: 0.001: 0.03%: 0.01%: bgp948118bgs.canton01.mi.comcast.net 147: 0.002: 0.03%: 0.01%: pcp04083155pcs.wanarb01.mi.comcast.net 147: 0.000: 0.01%: 0.01%: bgp01067831bgs.taylor01.mi.comcast.net 147: 0.000: 0.01%: 0.01%: nic-29-c121-158.twmi.rr.com 147: 0.002: 0.03%: 0.01%: 12.8.2.98 147: 0.000: 0.01%: 0.01%: bgp01080567bgs.wanarb01.mi.comcast.net 146: 0.000: 0.01%: 0.01%: 1cust54.tnt10.det5.da.uu.net 146: 0.001: 0.01%: 0.01%: 141-213-237-148.v-dent-arbl.umnet.umich.edu 146: 0.000: 0.01%: 0.01%: pcp02122686pcs.waldlk01.mi.comcast.net 146: 0.001: 0.02%: 0.01%: 1cust215.tnt5.det5.da.uu.net 146: 0.000: 0.01%: 0.01%: 0x50a27ed6.boanxx13.adsl.tele.dk 146: 0.000: : 0.01%: d60-239-140.try.wideopenwest.com 146: 0.000: 0.01%: 0.01%: hendymac.geo.lsa.umich.edu 146: 0.000: 0.01%: 0.01%: msufame.msu.edu 146: 0.000: : 0.01%: d60-67-248.try.wideopenwest.com 146: 0.000: 0.01%: 0.01%: 165.215.90.179 146: 0.000: 0.01%: 0.01%: 198.109.0.236 146: 0.002: 0.03%: 0.01%: host-108.subnet-193.med.umich.edu 146: 0.002: 0.03%: 0.01%: cache-rb04.proxy.aol.com 145: 0.001: 0.02%: 0.01%: 141.211.178.177 145: 0.000: : 0.01%: adsl-68-21-56-126.dsl.sfldmi.ameritech.net 145: 0.000: 0.01%: 0.01%: adsl-66-72-183-210.dsl.sfldmi.ameritech.net 145: 0.000: 0.01%: 0.01%: ns1.dol-esa.gov 145: 0.001: 0.02%: 0.01%: pcp02713725pcs.ypeast01.mi.comcast.net 145: 0.000: 0.01%: 0.01%: pm659-46.dialip.mich.net 145: 0.000: 0.01%: 0.01%: pcp02640515pcs.wanarb01.mi.comcast.net 145: 0.000: 0.01%: 0.01%: adsl-68-74-14-198.dsl.sfldmi.ameritech.net 145: 0.000: 0.01%: 0.01%: pcp02995568pcs.stclar01.mi.comcast.net 144: 0.001: 0.02%: 0.01%: purple.engin.umich.edu 144: 0.000: 0.01%: 0.01%: lsanca2-ar28-4-47-241-153.lsanca2.dsl-verizon.net 144: 0.000: 0.01%: 0.01%: 63.144.69.226 144: 0.000: 0.01%: 0.01%: d53-232-236.try.wideopenwest.com 144: 0.000: 0.01%: 0.01%: bgp960643bgs.derbrh01.mi.comcast.net 144: 0.000: 0.01%: 0.01%: tln-ts.tln.lib.mi.us 144: 0.003: 0.04%: 0.01%: mahide50.dow.com 144: 0.000: 0.01%: 0.01%: 216.0.242.58 144: 0.000: 0.01%: 0.01%: bgp01076073bgs.wanarb01.mi.comcast.net 144: 0.001: 0.01%: 0.01%: 1cust123.tnt33.det5.da.uu.net 144: 0.001: 0.01%: 0.01%: bgp996816bgs.nanarb01.mi.comcast.net 144: 0.000: 0.01%: 0.01%: 141.211.129.242 144: 0.000: 0.01%: 0.01%: bgp01059574bgs.taylor01.mi.comcast.net 143: 0.000: 0.01%: 0.01%: 66.80.202.140 143: 0.000: 0.01%: 0.01%: ip-64-32-197-130.dsl.iad.megapath.net 143: 0.001: 0.02%: 0.01%: pcp04062296pcs.nanarb01.mi.comcast.net 143: 0.000: 0.01%: 0.01%: 134-173.univunions.dsa.umich.edu 143: 0.000: 0.01%: 0.01%: 141.211.77.197 143: 0.000: 0.01%: 0.01%: adsl-66-73-2-242.dsl.sfldmi.ameritech.net 143: 0.000: : 0.01%: cache-rc07.proxy.aol.com 143: 0.001: 0.02%: 0.01%: 65-245-125-22-xdsl.michonline.net 143: 0.000: : 0.01%: cache-rk03.proxy.aol.com 143: 0.000: 0.01%: 0.01%: 199.105.198.163 143: 0.000: : 0.01%: 199.250.65.70 143: 0.001: 0.02%: 0.01%: 219.65.179.92 143: 0.001: 0.02%: 0.01%: pcp01158623pcs.rocsth01.mi.comcast.net 143: 0.000: 0.01%: 0.01%: ip209-36.ip2go.com 143: 0.000: 0.01%: 0.01%: dialup-22.eecs.umich.edu 143: 0.003: 0.05%: 0.01%: host50-199.sph.umich.edu 143: 0.000: 0.01%: 0.01%: c11b231.neo.lrun.com 142: 0.000: : 0.01%: proxy1.sunyrockland.edu 142: 0.000: 0.01%: 0.01%: deanfybtv.dean.lsa.umich.edu 142: 0.000: : 0.01%: 141.215.16.240 142: 0.000: 0.01%: 0.01%: 1cust108.tnt34.det3.da.uu.net 142: 0.000: 0.01%: 0.01%: adsl-65-42-36-66.dsl.sfldmi.ameritech.net 142: 0.000: : 0.01%: pm482-23.dialip.mich.net 142: 0.000: 0.01%: 0.01%: dialup-67.72.196.99.dial1.detroit1.level3.net 141: 0.000: : 0.01%: rdsacks-pc8.chem.lsa.umich.edu 141: 0.000: : 0.01%: d60-232-255.try.wideopenwest.com 141: 0.000: 0.01%: 0.01%: 64-51-155-242.client.dsl.net 141: 0.002: 0.03%: 0.01%: proxy242.bankone.com 141: 0.005: 0.07%: 0.01%: 22-236-234-66.cosmoweb.net 141: 0.004: 0.05%: 0.01%: cache-dp06.proxy.aol.com 141: 0.000: 0.01%: 0.01%: 164.76.238.218 141: 0.001: 0.02%: 0.01%: adsl-68-21-34-116.dsl.sfldmi.ameritech.net 141: 0.000: : 0.01%: cache-2.atw.pa.webcache.rcn.net 141: 0.000: : 0.01%: mail.americaspromise.org 141: 0.000: 0.01%: 0.01%: 0-1pool133-118.nas23.pittsfield-township2.mi.us.da.qwest.net 141: 0.000: 0.01%: 0.01%: pcp01193763pcs.waldlk01.mi.comcast.net 141: 0.000: 0.01%: 0.01%: 65.215.83.3 141: 0.001: 0.02%: 0.01%: 65.89.12.2 141: 0.001: 0.02%: 0.01%: nic-29-c97-250.twmi.rr.com 141: 0.001: 0.01%: 0.01%: pcp04053579pcs.wbrmfd01.mi.comcast.net 141: 0.000: 0.01%: 0.01%: 12.10.219.45 140: 0.000: 0.01%: 0.01%: swt028.skywiretechnology.com 140: 0.000: 0.01%: 0.01%: adsl-67-38-3-195.dsl.sfldmi.ameritech.net 140: 0.000: 0.01%: 0.01%: pcp01945231pcs.canton01.mi.comcast.net 140: 0.000: : 0.01%: 124.229.8.67.cfl.rr.com 140: 0.000: : 0.01%: bgp01136752bgs.ypwest01.mi.comcast.net 140: 0.000: 0.01%: 0.01%: bgp926929bgs.brghtn01.mi.comcast.net 140: 0.000: 0.01%: 0.01%: user-2injl5t.dialup.mindspring.com 140: 0.000: 0.01%: 0.01%: hydrogen.engin.umich.edu 140: 0.000: 0.01%: 0.01%: pcp01924763pcs.canton01.mi.comcast.net 140: 0.000: 0.01%: 0.01%: 141.213.137.18 140: 0.002: 0.03%: 0.01%: 157.199.6.37 140: 0.000: 0.01%: 0.01%: adsl-67-38-1-151.dsl.sfldmi.ameritech.net 140: 0.000: 0.01%: 0.01%: cache-rp05.proxy.aol.com 140: 0.000: 0.01%: 0.01%: dialup-67.26.11.231.dial1.detroit1.level3.net 139: 0.000: 0.01%: 0.01%: 209.212.204.254 139: 0.000: 0.01%: 0.01%: pcp03619264pcs.brghtn01.mi.comcast.net 139: 0.000: 0.01%: 0.01%: cpe-024-210-100-168.twmi.rr.com 139: 0.003: 0.04%: 0.01%: cache-mtc-ab10.proxy.aol.com 139: 0.000: 0.01%: 0.01%: adsl-66-72-2-230.dsl.sfldmi.ameritech.net 139: 0.000: : 0.01%: 205.218.80.11 139: 0.000: 0.01%: 0.01%: 152.160.76.92 139: 0.000: 0.01%: 0.01%: bridge.engin.umich.edu 139: 0.000: : 0.01%: adsl-65-43-33-116.dsl.lgtpmi.ameritech.net 139: 0.000: 0.01%: 0.01%: 1cust66.tnt19.det3.da.uu.net 139: 0.000: 0.01%: 0.01%: 63.146.80.23 139: 0.002: 0.03%: 0.01%: 216.93.80.6 139: 0.000: 0.01%: 0.01%: 69.14.241.80 139: 0.000: 0.01%: 0.01%: 165.215.34.55 139: 0.000: 0.01%: 0.01%: kpssdc.kp.org 139: 0.000: 0.01%: 0.01%: pcp01783317pcs.plyntv01.mi.comcast.net 139: 0.000: 0.01%: 0.01%: 1cust165.tnt17.det5.da.uu.net 139: 0.000: 0.01%: 0.01%: 66.227.205.30.bay.mi.chartermi.net 139: 0.000: 0.01%: 0.01%: dpc6682009014.direcpc.com 139: 0.000: 0.01%: 0.01%: 65.208.207.3 138: 0.002: 0.03%: 0.01%: d14-69-71-105.try.wideopenwest.com 138: 0.000: 0.01%: 0.01%: 4.2.160.34 138: 0.000: 0.01%: 0.01%: pe-el-jharvey1.bf.umich.edu 138: 0.000: 0.01%: 0.01%: dialup-67.72.206.7.dial1.detroit1.level3.net 138: 0.000: 0.01%: 0.01%: adsl-64-216-136-185.dsl.kscymo.swbell.net 138: 0.000: 0.01%: 0.01%: bgp997321bgs.nanarb01.mi.comcast.net 138: 0.000: 0.01%: 0.01%: adsl-35-247-176.msy.bellsouth.net 138: 0.000: 0.01%: 0.01%: bgp01070365bgs.vnburn01.mi.comcast.net 138: 0.000: : 0.01%: 207.86.123.243 138: 0.001: 0.01%: 0.01%: launceston-atm.vic-remote.bigpond.net.au 138: 0.000: 0.01%: 0.01%: pool0118.cvx28-bradley.dialup.earthlink.net 138: 0.000: 0.01%: 0.01%: 141.211.253.103 138: 0.001: 0.01%: 0.01%: adsl-67-38-8-246.dsl.sfldmi.ameritech.net 138: 0.000: 0.01%: 0.01%: dhcp10690.net.plm.eds.com 138: 0.000: 0.01%: 0.01%: cache-mtc-ag04.proxy.aol.com 138: 0.000: 0.01%: 0.01%: weymouth3.engin.umich.edu 138: 0.002: 0.03%: 0.01%: cache1.pal.ptd.net 138: 0.000: 0.01%: 0.01%: w222.z067104208.det-mi.dsl.cnc.net 138: 0.000: : 0.01%: rfield1.rdg.boehringer-ingelheim.com 138: 0.000: 0.01%: 0.01%: aca10ddc.ipt.aol.com 138: 0.000: 0.01%: 0.01%: 95.detroit17rh16rt.mi.dial-access.att.net 137: 0.000: 0.01%: 0.01%: adsl-68-74-1-28.dsl.sfldmi.ameritech.net 137: 0.001: 0.01%: 0.01%: ac919de2.ipt.aol.com 137: 0.000: 0.01%: 0.01%: 65.240.105.1 137: 0.000: 0.01%: 0.01%: 198.36.89.4 137: 0.000: 0.01%: 0.01%: host218-206.sph.umich.edu 137: 0.001: 0.03%: 0.01%: 12-245-210-129.client.attbi.com 137: 0.000: : 0.01%: pcp03534559pcs.alico01.fl.comcast.net 137: 0.001: 0.02%: 0.01%: bgp01136344bgs.ypwest01.mi.comcast.net 137: 0.000: 0.01%: 0.01%: av-tr-lschmalt.bf.umich.edu 137: 0.000: 0.01%: 0.01%: 64.240.82.150 137: 0.000: 0.01%: 0.01%: bgp994948bgs.nanarb01.mi.comcast.net 137: 0.000: 0.01%: 0.01%: 1114111455.mi.dial.hexcom.net 137: 0.000: : 0.01%: bgp921490bgs.airprt01.mi.comcast.net 137: 0.000: 0.01%: 0.01%: adsl-67-38-22-54.dsl.sfldmi.ameritech.net 137: 0.000: 0.01%: 0.01%: 64.215.87.3 137: 0.001: 0.02%: 0.01%: atlasoil.com 136: 0.001: 0.01%: 0.01%: 207.148.197.156 136: 0.001: 0.02%: 0.01%: bgp01135303bgs.ypeast01.mi.comcast.net 136: 0.002: 0.03%: 0.01%: pcp01990639pcs.waren401.mi.comcast.net 136: 0.000: 0.01%: 0.01%: tnt02-66-185.sfld.provide.net 136: 0.000: 0.01%: 0.01%: 198.108.102.120 136: 0.000: 0.01%: 0.01%: px4ar.ed.shawcable.net 136: 0.001: 0.01%: 0.01%: 1cust198.tnt1.flat-rock.mi.da.uu.net 136: 0.000: 0.01%: 0.01%: adsl-67-36-78-222.dsl.sfldmi.ameritech.net 136: 0.000: 0.01%: 0.01%: 129.128.149.87 136: 0.000: 0.01%: 0.01%: catv096004.usr.hananet.net 136: 0.001: 0.02%: 0.01%: bgp01016037bgs.rosvle01.mi.comcast.net 136: 0.000: 0.01%: 0.01%: 199.97.64.16 135: 0.000: 0.01%: 0.01%: cpe-24-221-65-46.mi.sprintbbd.net 135: 0.000: 0.01%: 0.01%: h642720637.ip.usabestnet.net 135: 0.000: 0.01%: 0.01%: 65-2162764.xo.wwnet.net 135: 0.000: 0.01%: 0.01%: 0-1pool208-98.nas11.lansing2.mi.us.da.qwest.net 135: 0.000: : 0.01%: host-203.subnet-164.med.umich.edu 135: 0.000: 0.01%: 0.01%: icetea.eecs.umich.edu 135: 0.000: 0.01%: 0.01%: dialup-67.72.196.247.dial1.detroit1.level3.net 135: 0.000: : 0.01%: dhcp024-208-248-220.twmi.rr.com 135: 0.000: 0.01%: 0.01%: ppp-66-73-184-26.dsl.sfldmi.ameritech.net 135: 0.000: 0.01%: 0.01%: 209.69.222.106 135: 0.000: 0.01%: 0.01%: baycity.engin.umich.edu 135: 0.000: 0.01%: 0.01%: pcp02399862pcs.flint01.mi.comcast.net 135: 0.000: 0.01%: 0.01%: 1cust67.tnt3.det5.da.uu.net 135: 0.000: : 0.01%: host-44.subnet-8.med.umich.edu 135: 0.000: 0.01%: 0.01%: dialup-67.25.219.160.dial1.detroit1.level3.net 134: 0.000: 0.01%: 0.01%: 141.211.205.119 134: 0.000: 0.01%: 0.01%: bgp01134006bgs.ypeast01.mi.comcast.net 134: 0.001: 0.02%: 0.01%: cache4.mayo.edu 134: 0.000: 0.01%: 0.01%: pcp02861047pcs.roylok01.mi.comcast.net 134: 0.001: 0.02%: 0.01%: nic-29-c97-136.twmi.rr.com 134: 0.000: 0.01%: 0.01%: user-2injkpj.dialup.mindspring.com 134: 0.001: 0.02%: 0.01%: pcp01563900pcs.sothfd01.mi.comcast.net 134: 0.000: 0.01%: 0.01%: msn166-250.med.und.nodak.edu 134: 0.001: 0.01%: 0.01%: 141.211.122.175 134: 0.000: 0.01%: 0.01%: px2nr.wp.shawcable.net 134: 0.001: 0.02%: 0.01%: pm636-38.dialip.mich.net 134: 0.000: 0.01%: 0.01%: dialup-67.72.207.11.dial1.detroit1.level3.net 134: 0.000: 0.01%: 0.01%: 141.217.109.44 134: 0.000: : 0.01%: zzz-216043183196.splitrock.net 134: 0.000: : 0.01%: d14-69-183-216.try.wideopenwest.com 134: 0.000: 0.01%: 0.01%: 24.247.123.146.kzo.mi.chartermi.net 134: 0.000: 0.01%: 0.01%: bgp01071590bgs.vnburn01.mi.comcast.net 134: 0.000: 0.01%: 0.01%: 198.173.220.50 134: 0.000: 0.01%: 0.01%: pm484-12.dialip.mich.net 134: 0.000: 0.01%: 0.01%: 169.135.117.19 134: 0.000: 0.01%: 0.01%: sin-itr-3-2k.si.umich.edu 134: 0.001: 0.02%: 0.01%: 208.253.34.36 134: 0.000: : 0.01%: dpc6682009039.direcpc.com 134: 0.000: : 0.01%: screen.weyco.com 134: 0.000: 0.01%: 0.01%: user-2injkaj.dialup.mindspring.com 134: 0.000: 0.01%: 0.01%: adsl-158-56-149.asm.bellsouth.net 133: 0.008: 0.11%: 0.01%: wfp2.almaden.ibm.com 133: 0.000: 0.01%: 0.01%: pm593-39.dialip.mich.net 133: 0.002: 0.03%: 0.01%: inet-fwi-b.phs.com 133: 0.001: 0.02%: 0.01%: adsl-65-42-44-179.hobbs-black.com 133: 0.000: 0.01%: 0.01%: pu-ap-crossett.bf.umich.edu 133: 0.001: 0.02%: 0.01%: dhcp091.glerl.noaa.gov 133: 0.000: 0.01%: 0.01%: bgp995542bgs.nanarb01.mi.comcast.net 133: 0.000: 0.01%: 0.01%: dialup-67.72.208.163.dial1.detroit1.level3.net 133: 0.002: 0.03%: 0.01%: pcp01154331pcs.newhav01.mi.comcast.net 133: 0.002: 0.03%: 0.01%: cache-rr02.proxy.aol.com 132: 0.000: : 0.01%: 67.105.193.172 132: 0.000: : 0.01%: 64.241.225.22 132: 0.002: 0.03%: 0.01%: miaa01-meierpe.erim-int.com 132: 0.000: 0.01%: 0.01%: 69.14.246.89 132: 0.000: 0.01%: 0.01%: pcp02871830pcs.stclar01.mi.comcast.net 132: 0.000: 0.01%: 0.01%: why186214.net.hfh.edu 132: 0.000: 0.01%: 0.01%: 1cust83.tnt1.howell.mi.da.uu.net 132: 0.000: : 0.01%: dialup-67.72.214.211.dial1.detroit1.level3.net 132: 0.002: 0.03%: 0.01%: ppp-66-73-177-254.dsl.sfldmi.ameritech.net 132: 0.001: 0.02%: 0.01%: adsl-67-38-86-190.dsl.sfldmi.ameritech.net 132: 0.000: 0.01%: 0.01%: bcccache6-4.tco.census.gov 132: 0.002: 0.03%: 0.01%: 63.148.99.232 132: 0.000: 0.01%: 0.01%: pm470-11.dialip.mich.net 132: 0.000: 0.01%: 0.01%: pcp02871826pcs.stclar01.mi.comcast.net 131: 0.000: 0.01%: 0.01%: 136.detroit18rh15rt.mi.dial-access.att.net 131: 0.000: 0.01%: 0.01%: pcp01109887pcs.clnt3401.mi.comcast.net 131: 0.000: 0.01%: 0.01%: adsl-66-73-217-215.dsl.sfldmi.ameritech.net 131: 0.000: 0.01%: 0.01%: 136.181.195.106 131: 0.000: 0.01%: 0.01%: g707pc1.engin.umich.edu 131: 0.000: 0.01%: 0.01%: pcp02255730pcs.wanarb01.mi.comcast.net 131: 0.000: 0.01%: 0.01%: pcp01924744pcs.canton01.mi.comcast.net 131: 0.000: : 0.01%: bgp948191bgs.canton01.mi.comcast.net 131: 0.000: : 0.01%: 129.9.163.233 131: 0.000: : 0.01%: d154.as2.lnng.mi.voyager.net 131: 0.000: : 0.01%: gw2.marsh.com 131: 0.000: 0.01%: 0.01%: 12.27.0.16 131: 0.000: 0.01%: 0.01%: pcp04172362pcs.macmb101.mi.comcast.net 131: 0.001: 0.02%: 0.01%: plnthelp-203.user.msu.edu 131: 0.000: 0.01%: 0.01%: pcp01743894pcs.wayne01.mi.comcast.net 131: 0.000: 0.01%: 0.01%: dialup-67.72.213.72.dial1.detroit1.level3.net 131: 0.001: 0.01%: 0.01%: 207.224.39.102 131: 0.000: 0.01%: 0.01%: 216.115.64.44 131: 0.000: : 0.01%: host-201.subnet-147.med.umich.edu 131: 0.000: 0.01%: 0.01%: 76.detroit05rh15rt.mi.dial-access.att.net 131: 0.000: 0.01%: 0.01%: tnt02-67-73.sfld.provide.net 130: 0.000: 0.01%: 0.01%: nic-29-c122-210.twmi.rr.com 130: 0.000: 0.01%: 0.01%: 89-201-112-64.tc3net.com 130: 0.002: 0.04%: 0.01%: 65.241.85.50 130: 0.000: : 0.01%: crt-v-099.crt.net 130: 0.000: 0.01%: 0.01%: proxy.txdps.state.tx.us 130: 0.000: 0.01%: 0.01%: 202.150.88.130 130: 0.000: 0.01%: 0.01%: ppp-66-73-176-204.dsl.sfldmi.ameritech.net 130: 0.000: 0.01%: 0.01%: pool-141-157-183-232.bos.east.verizon.net 130: 0.001: 0.01%: 0.01%: proxy.ia3.marketscore.com 129: 0.001: 0.01%: 0.01%: as02-def-mi-1-98.rasserver.net 129: 0.002: 0.03%: 0.01%: pcp03576390pcs.wodhvn01.mi.comcast.net 129: 0.000: : 0.01%: cache-mtc-ab03.proxy.aol.com 129: 0.000: 0.01%: 0.01%: adsl-67-38-11-255.dsl.sfldmi.ameritech.net 129: 0.000: : 0.01%: 12-249-79-172.client.attbi.com 129: 0.000: 0.01%: 0.01%: bgp927869bgs.brghtn01.mi.comcast.net 129: 0.001: 0.02%: 0.01%: adsl-68-21-41-183.dsl.sfldmi.ameritech.net 129: 0.001: 0.01%: 0.01%: pool-151-201-37-163.pitt.east.verizon.net 129: 0.001: 0.02%: 0.01%: 146.9.58.151 129: 0.000: 0.01%: 0.01%: 141.211.122.230 129: 0.000: 0.01%: 0.01%: amapp-pc1.chem.lsa.umich.edu 129: 0.000: 0.01%: 0.01%: pcp01924611pcs.canton01.mi.comcast.net 129: 0.000: : 0.01%: accbd85b.ipt.aol.com 129: 0.000: 0.01%: 0.01%: pcp04068460pcs.sanarb01.mi.comcast.net 129: 0.000: 0.01%: 0.01%: pcp03174690pcs.flshng01.mi.comcast.net 129: 0.000: 0.01%: 0.01%: 189.suaa.detr.sfldmibv.dsl.att.net 129: 0.001: 0.02%: 0.01%: cache-dk02.proxy.aol.com 129: 0.000: 0.01%: 0.01%: dialup-67.72.215.13.dial1.detroit1.level3.net 129: 0.000: 0.01%: 0.01%: pcp02996365pcs.stclar01.mi.comcast.net 128: 0.000: 0.01%: 0.01%: adsl-68-21-38-230.dsl.sfldmi.ameritech.net 128: 0.000: 0.01%: 0.01%: cache.walshcol.edu 128: 0.000: 0.01%: 0.01%: 12.150.63.67 128: 0.000: 0.01%: 0.01%: dialup-67.72.206.118.dial1.detroit1.level3.net 128: 0.000: : 0.01%: 141-211-30-217.bus.umich.edu 128: 0.000: 0.01%: 0.01%: 67.37.70.58 128: 0.000: : 0.01%: nat.detroit.lib.mi.us 128: 0.001: 0.02%: 0.01%: dialup-67.72.203.16.dial1.detroit1.level3.net 128: 0.002: 0.03%: 0.01%: 206.18.209.2 128: 0.000: : 0.01%: 1cust172.tnt2.marion.oh.da.uu.net 128: 0.000: 0.01%: 0.01%: h-66-134-148-174.sfldmidn.covad.net 128: 0.000: 0.01%: 0.01%: 1cust104.tnt19.det5.da.uu.net 128: 0.000: 0.01%: 0.01%: 65.217.107.232 128: 0.001: 0.02%: 0.01%: adsl-68-21-35-98.dsl.sfldmi.ameritech.net 128: 0.000: : 0.01%: pm636-33.dialip.mich.net 128: 0.000: 0.01%: 0.01%: 48-pool1.ras11.misou.alerondial.net 128: 0.001: 0.03%: 0.01%: 73-2162764.xo.wwnet.net 128: 0.000: 0.01%: 0.01%: pcp04150913pcs.sanarb01.mi.comcast.net 128: 0.000: : 0.01%: 207.0.238.42 128: 0.000: 0.01%: 0.01%: usr32-023.provide.net 127: 0.000: : 0.01%: bgp01076715bgs.wanarb01.mi.comcast.net 127: 0.000: : 0.01%: user-2injk5l.dialup.mindspring.com 127: 0.001: 0.02%: 0.01%: adsl-83-188-117.sav.bellsouth.net 127: 0.000: 0.01%: 0.01%: 63.97.201.15 127: 0.000: 0.01%: 0.01%: d14-69-202-109.try.wideopenwest.com 127: 0.000: 0.01%: 0.01%: westquad-191-227.reshall.umich.edu 127: 0.001: 0.02%: 0.01%: webproxy2.per-se.com 127: 0.000: : 0.01%: inktomi2-bre.server.ntl.com 127: 0.000: 0.01%: 0.01%: bgp946195bgs.canton01.mi.comcast.net 127: 0.000: 0.01%: 0.01%: host38.64-79-74.bignet.net 127: 0.000: : 0.01%: adsl-68-21-47-48.dsl.sfldmi.ameritech.net 127: 0.001: 0.01%: 0.01%: 63.238.239.220 127: 0.000: : 0.01%: pcp04113607pcs.plyntv01.mi.comcast.net 127: 0.000: 0.01%: 0.01%: net143128.hurleymc.com 127: 0.000: 0.01%: 0.01%: d105.as1.stbr.mi.voyager.net 126: 0.002: 0.03%: 0.01%: m151190.ap.plala.or.jp 126: 0.002: 0.03%: 0.01%: ns25.statefarm.com 126: 0.000: 0.01%: 0.01%: dialup-64.159.101.100.dial1.cleveland1.level3.net 126: 0.000: 0.01%: 0.01%: 207.179.107.170 126: 0.001: 0.03%: 0.01%: c-67-162-211-58.client.comcast.net 126: 0.000: : 0.01%: host-146.subnet-191.med.umich.edu 126: 0.000: 0.01%: 0.01%: 141.211.55.214 126: 0.000: : 0.01%: 160.94.145.195 126: 0.000: 0.01%: 0.01%: adsl-64-108-53-217.dsl.sfldmi.ameritech.net 126: 0.000: 0.01%: 0.01%: adsl-67-38-27-118.dsl.sfldmi.ameritech.net 126: 0.000: 0.01%: 0.01%: bgp997843bgs.nanarb01.mi.comcast.net 126: 0.000: 0.01%: 0.01%: 12.105.72.130 126: 0.000: 0.01%: 0.01%: pcp02392907pcs.flint01.mi.comcast.net 126: 0.000: : 0.01%: spider-mtc-th022.proxy.aol.com 126: 0.000: 0.01%: 0.01%: pcp02625688pcs.stclar01.mi.comcast.net 126: 0.000: 0.01%: 0.01%: 24.236.133.150.bay.mi.chartermi.net 126: 0.000: 0.01%: 0.01%: cache01.flow.com.au 125: 0.000: : 0.01%: asb-65x5h11.byu.edu 125: 0.000: 0.01%: 0.01%: bgp948881bgs.canton01.mi.comcast.net 125: 0.000: 0.01%: 0.01%: adsl-67-38-25-149.dsl.sfldmi.ameritech.net 125: 0.000: 0.01%: 0.01%: 198.111.173.116 125: 0.000: 0.01%: 0.01%: dhcp221.glerl.noaa.gov 125: 0.000: 0.01%: 0.01%: pcp04149063pcs.sanarb01.mi.comcast.net 125: 0.000: 0.01%: 0.01%: 217-p47.modempool.com 125: 0.000: :
